Crystal Structure of the G17E/A52V/S54N/Q72H/E80V/L81S/T87S/G96V variant of the murine T cell receptor V beta 8.2 domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 21 Mar 2006.
Explore 2APV in 3D Show helices and sheets RCSB PDB PDBe
2APV contains 1 α-helix and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 31-37 | 7 | 2 |
| β-strand | 43-49 | 7 | 2 |
| β-strand | 56-57 | 2 | 2 |
| β-strand | 66-71 | 6 | 1 |
| β-strand | 74-79 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 2 |
| β-strand | 99-108 | 4 | 2 |
| β-strand | 112-116 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| T cell receptor beta chain V | A | protein | 112 | Rattus norvegicus | P04213 (AlphaFold model) |
>2APV_1 T cell receptor beta chain V (chains A) ILEAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGVGNTEKG DIPDGYKASRPSHEQFSLILVSATPSQSSVYFCASGVGGTLYFGAGTRLSVL
| ID | Name | Formula | Copies |
|---|---|---|---|
| MLA | Malonic acid | C3 H4 O4 | 3 |
Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction. Cho, S., Swaminathan, C.P., Yang, J. et al. Structure (2005) 13:1775-1787. DOI 10.1016/j.str.2005.08.015 · PubMed
Other PDB entries of the same protein (UniProt P04213 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2APV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.