The solution structure of the membrane proximal cytokine receptor domain of the human interleukin-6 receptor. Determined by solution NMR. Released 12 Sept 2006.
Explore 2ARW in 3D Show helices and sheets RCSB PDB PDBe
2ARW contains 1 α-helix and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-9 | 4 | |
| β-strand | 10-15 | 6 | 1 |
| β-strand | 25-29 | 5 | 1 |
| β-strand | 43 | 1 | 2 |
| β-strand | 46-49 | 4 | 3 |
| β-strand | 56 | 1 | 3 |
| β-strand | 66-68 | 3 | 1 |
| β-strand | 78-81 | 4 | 3 |
| β-strand | 84 | 1 | 2 |
| β-strand | 99-102 | 4 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-6 receptor alpha chain | A | protein | 126 | Homo sapiens | P08887 (AlphaFold model) |
>2ARW_1 Interleukin-6 receptor alpha chain (chains A) MGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMV KDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTP MQALTT
The solution structure of the membrane-proximal cytokine receptor domain of the human interleukin-6 receptor. Hecht, O., Dingley, A.J., Schwanter, A. et al. Biol Chem (2006) 387:1255-1259. DOI 10.1515/BC.2006.155 · PubMed
Other PDB entries of the same protein (UniProt P08887 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2ARW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.