Scorpion toxin LQH-alpha-IT. Determined by X-ray diffraction at 1.1 Å resolution. Released 5 Sept 2006.
Explore 2ASC in 3D Show helices and sheets RCSB PDB PDBe
2ASC contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 1 |
| β-strand | 7 | 1 | 2 |
| β-strand | 8-9 | 2 | 3 |
| β-strand | 13-14 | 2 | 3 |
| α-helix | 15 | 1 | |
| β-strand | 16 | 1 | 1 |
| α-helix | 20-29 | 10 | |
| β-strand | 34-41 | 8 | 1 |
| β-strand | 44-53 | 10 | 1 |
| β-strand | 58 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| neurotoxin alpha-IT | A | protein | 65 | Leiurus quinquestriatus | P17728 (AlphaFold model) |
>2ASC_1 neurotoxin alpha-IT (chains A) MVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRV PGKCR
| ID | Name | Formula | Copies |
|---|---|---|---|
| EOH | Ethanol | C2 H6 O | 3 |
| MOH | Methanol | C H4 O | 3 |
| DR0 | N-(hydroxymethyl)-n,n-dimethylhexan-1-aminium | C9 H22 N O | 1 |
| DR8 | N,n,n-trimethylhepta-1,3,5-triyn-1-aminium | C10 H12 N | 1 |
Water and common crystallization additives (EDO, K, NO3, CL) are not listed.
X-ray structures of Lqh-alpha-IT and Lqh-alpha-IT8D9D10V mutant. Kahn, R., Karbat, I., Gurevitz, M. et al. To be published.
Other PDB entries of the same protein (UniProt P17728 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2ASC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.