kinetics, stability, and structural changes in high resolution crystal structures of HIV-1 protease with drug resistant mutations L24I, I50V, and G73S. Determined by X-ray diffraction at 1.1 Å resolution. Released 24 Jan 2006.
Explore 2AVS in 3D Show helices and sheets RCSB PDB PDBe
2AVS contains 3 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 2 |
| β-strand | 18-24 | 7 | 2 |
| β-strand | 32-34 | 3 | 2 |
| β-strand | 43-49 | 7 | 2 |
| β-strand | 52-66 | 15 | 2 |
| β-strand | 69-78 | 10 | 2 |
| β-strand | 84-85 | 2 | 2 |
| α-helix | 87-90 | 4 | |
| α-helix | 91-93 | 3 | |
| β-strand | 96-98 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 3 |
| β-strand | 18-24 | 7 | 3 |
| β-strand | 32-33 | 2 | 3 |
| β-strand | 43-49 | 7 | 3 |
| β-strand | 52-66 | 15 | 3 |
| β-strand | 69-77 | 9 | 3 |
| β-strand | 84-85 | 2 | 3 |
| α-helix | 87-90 | 4 | |
| β-strand | 96-98 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pol polyprotein | A, B | protein | 99 | Human immunodeficiency virus 1 | P04587 |
>2AVS_1 Pol polyprotein (chains A, B) PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGVGGFIKVRQYD QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
| ID | Name | Formula | Copies |
|---|---|---|---|
| MK1 | N-[2(R)-hydroxy-1(S)-indanyl]-5-[(2(S)-tertiary butylaminocarbonyl)-4(3-pyridyl… | C36 H47 N5 O4 | 1 |
| PO4 | Phosphate ion | O4 P | 2 |
Water and common crystallization additives (ACY, DMS, SO4) are not listed.
Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S. Liu, F., Boross, P.I., Wang, Y.F. et al. J Mol Biol (2005) 354:789-800. DOI 10.1016/j.jmb.2005.09.095 · PubMed
Other PDB entries of the same protein (UniProt P04587), best resolution first:
MolViewer shows 2AVS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.