3CYX: HIV-1 mutant I50V and inhibitor saquinavira

Crystal structure of HIV-1 mutant I50V and inhibitor saquinavira. Determined by X-ray diffraction at 1.2 Å resolution. Released 27 May 2008.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Human immunodeficiency virus 1
Chains: 2
Atoms: 1,977
Mol. weight: 22.39 kDa
Ligands: PO4, ROC
Released: 27 May 2008

Explore 3CYX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CYX contains 2 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	10-15	6	2
β-strand	18-24	7	2
β-strand	32-33	2	2
β-strand	42-49	8	2
β-strand	52-66	15	2
β-strand	69-77	9	2
β-strand	84-85	2	2
α-helix	87-90	4
β-strand	96-98	3	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	10-15	6	3
β-strand	18-24	7	3
β-strand	32-33	2	3
β-strand	43-49	7	3
β-strand	52-66	15	3
β-strand	69-77	9	3
β-strand	84-85	2	3
α-helix	87-90	4
β-strand	96-98	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV-1 Protease	A, B	protein	99	Human immunodeficiency virus 1	P04587

Sequence of entity 1 (A, B), FASTA

>3CYX_1 HIV-1 Protease (chains A, B)
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGVGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1
ROC	(2S)-N-[(2S,3R)-4-[(2S,3S,4aS,8aS)-3-(tert-butylcarbamoyl)-3,4,4a,5,6,7,8,8a-oc…	C38 H50 N6 O5	1

Water and common crystallization additives (GOL, ACY, NA) are not listed.

Primary citation

Effect of flap mutations on structure of HIV-1 protease and inhibition by saquinavir and darunavir. Liu, F., Kovalevsky, A.Y., Tie, Y. et al. J Mol Biol (2008) 381:102-115. DOI 10.1016/j.jmb.2008.05.062 · PubMed

Other PDB entries of the same protein (UniProt P04587), best resolution first:

2NMZ 0.97 Å, Crystal structure analysis of HIV-1 protease mutant V82A with a inhibitor saquinavir
3D1X 1.05 Å, Crystal structure of HIV-1 mutant I54M and inhibitor saquinavir
3D1Y 1.05 Å, Crystal structure of HIV-1 mutant I54V and inhibitor SAQUINA
3D20 1.05 Å, Crystal structure of HIV-1 mutant I54V and inhibitor DARUNAVIA
2AOG 1.1 Å, Crystal structure analysis of HIV-1 protease mutant V82A with a substrate analog P2-NC
2AVM 1.1 Å, Kinetics, stability, and structural changes in high resolution crystal structures of…
2AVO 1.1 Å, Kinetics, stability, and structural changes in high resolution crystal structures of…
2AVS 1.1 Å, kinetics, stability, and structural changes in high resolution crystal structures of…
2NMY 1.1 Å, Crystal structure analysis of HIV-1 protease mutant V82A with a inhibitor saquinavir
3OXC 1.16 Å, Wild Type HIV-1 Protease with Antiviral Drug Saquinavir
1K1T 1.2 Å, Combining Mutations in HIV-1 Protease to Understand Mechanisms of Resistance
2NNP 1.2 Å, Crystal structure analysis of HIV-1 protease mutant I84V with a inhibitor saquinavir

Browse structure collections

About this viewer

MolViewer shows 3CYX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.