2AXC: ColE7 translocation domain

Crystal structure of ColE7 translocation domain. Determined by X-ray diffraction at 1.7 Å resolution. Released 14 Mar 2006.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Escherichia coli str. K12 substr.
Chains: 1
Atoms: 2,017
Mol. weight: 27.78 kDa
Released: 14 Mar 2006

Explore 2AXC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AXC contains 13 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	80-82	3
β-strand	83	1	1
α-helix	84	1
β-strand	89-91	3	2
β-strand	94	1	3
β-strand	97	1	3
β-strand	98-102	5	4
α-helix	105-108	4
α-helix	109-116	8
β-strand	127-134	8	5
α-helix	136-142	7
β-strand	149-155	7	2
α-helix	156-158	3
α-helix	164-166	3
β-strand	173-176	4	6
β-strand	179-185	7	5
β-strand	188-195	8	5
β-strand	199-202	4	6
β-strand	203-205	3	2
β-strand	207-208	2	4
β-strand	214-219	6	4
β-strand	222-229	8	4
β-strand	236	1	1
α-helix	238-240	3
β-strand	243-245	3	5
α-helix	246-247	2
β-strand	252-253	2	5
β-strand	262-268	7	2
α-helix	269-270	2
α-helix	271-273	3
α-helix	275-277	3
β-strand	278-284	7	2
α-helix	288-307	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Colicin E7	A	protein	264	Escherichia coli str. K12 substr.	Q47112 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2AXC_1 Colicin E7 (chains A)
MRGSRSGHGNGGGNSNSGGGSNSSVAAPMAFGFPALAAPGAGTLGISVSGEALSAAIADI
FAALKGPFKFSAWGIALYGILPSEIAKDDPNMMSKIVTSLPAETVTNVQVSTLPLDQATV
SVTKRVTDVVKDTRQHIAVVAGVPMSVPVVNAKPTRTPGVFHASFPGVPSLTVSTVKGLP
VSTTLPRGITEDKGRTAVPAGFTFGGGSHEAVIRFPKESGQKPVYVSVTDVLTPAQVKQR
QDEEKRLQQEWNDAHPVEVAERRS

Primary citation

High-resolution crystal structure of a truncated ColE7 translocation domain: implications for colicin transport across membranes. Cheng, Y.S., Shi, Z., Doudeva, L.G. et al. J Mol Biol (2006) 356:22-31. DOI 10.1016/j.jmb.2005.11.056 · PubMed

Other PDB entries of the same protein (UniProt Q47112 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZFK 1.7 Å, N-terminal truncated Nuclease Domain of Colicin E7
2JB0 1.91 Å, Crystal structure of the mutant H573A of the nuclease domain of COLE7 in complex with IM7
1MZ8 2.0 Å, Crystal structures of the nuclease domain of COLE7/IM7 in complex with a phosphate ion…
1ZNV 2.0 Å, How a His-metal finger endonuclease ColE7 binds and cleaves DNA with a transition metal…
2ERH 2.0 Å, Crystal Structure of the E7_G/Im7_G complex; a designed interface between the colicin E7…
2JAZ 2.03 Å, Crystal structure of the mutant N560D of the nuclease domain of COLE7 in complex with IM7
1M08 2.1 Å, Crystal structure of the unbound nuclease domain of ColE7
1UJZ 2.1 Å, Crystal structure of the E7_C/Im7_C complex; a computationally designed interface…
2JBG 2.2 Å, crystal structure of the mutant N560A of the nuclease domain of ColE7 in complex with Im7
3GKL 2.2 Å, Following evolutionary paths to high affinity and selectivity protein-protein…
7CEI 2.3 Å, The endonuclease domain of colicin E7 in complex with its inhibitor IM7 protein
3GJN 2.48 Å, Following evolutionary paths to high affinity and selectivity protein-protein…

Browse structure collections

About this viewer

MolViewer shows 2AXC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.