2AXW: DraD invasin from uropathogenic Escherichia coli

Structure of DraD invasin from uropathogenic Escherichia coli. Determined by X-ray diffraction at 1.05 Å resolution. Released 1 Nov 2005.

Method: X-ray diffraction
Resolution: 1.05 Å
Organism: Escherichia coli
Chains: 2
Atoms: 2,412
Mol. weight: 29.55 kDa
Released: 1 Nov 2005

Explore 2AXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AXW contains 6 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
α-helix	14	1
β-strand	15	1	2
α-helix	16	1
β-strand	20-27	8	1
β-strand	34-39	6	1
β-strand	42-43	2	1
β-strand	50-55	6	1
β-strand	61-67	7	1
β-strand	72-73	2	1
α-helix	74-75	2
β-strand	82-85	4	1
β-strand	90-97	8	1
β-strand	101	1	2
β-strand	106-123	18	1
α-helix	124-126	3
β-strand	127-133	7	1

Chain B: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	14-15	2	3
β-strand	20-27	8	1
β-strand	34-39	6	1
β-strand	42-43	2	1
β-strand	50-55	6	1
β-strand	61-67	7	1
β-strand	72-73	2	1
α-helix	74-75	2
β-strand	82-85	4	1
β-strand	90-97	8	1
β-strand	101-102	2	3
β-strand	106-123	18	1
α-helix	124-126	3
β-strand	127-133	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DraD invasin	A, B	protein	134	Escherichia coli	Q47038 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2AXW_1 DraD invasin (chains A, B)
AELHLESRGGSGTQLRDGAKVATGRIICREAHTGFHVWMNERQVDGRAERYVVQSKDGRH
ELRVRTGGDGWSPVKGEGGKGVSRPGQEEQVFFDVMADGNQDIAPGEYRFSVGGACVVPQ
EKLAAALEHHHHHH

Primary citation

Structure of DraD invasin from uropathogenic Escherichia coli: a dimer with swapped beta-tails. Jedrzejczak, R., Dauter, Z., Dauter, M. et al. Acta Crystallogr D Biol Crystallogr (2006) 62:157-164. DOI 10.1107/S0907444905036747 · PubMed

Other PDB entries of the same protein (UniProt Q47038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FVN The fibrillar tip complex of the Afa/Dr adhesins from pathogen E. coli displays…
2IXQ The solution structure of the invasive tip complex from Afa-Dr fibrils

Browse structure collections

About this viewer

MolViewer shows 2AXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.