The fibrillar tip complex of the Afa/Dr adhesins from pathogen E. coli displays synergistic binding to 5 1 and v 3 integrins. Determined by solution NMR. Released 27 Feb 2007.
Explore 2FVN in 3D Show helices and sheets RCSB PDB PDBe
2FVN contains 1 α-helix and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 1 |
| β-strand | 21-24 | 4 | 2 |
| β-strand | 27-28 | 2 | 3 |
| β-strand | 36-38 | 3 | 4 |
| β-strand | 54-55 | 2 | 5 |
| β-strand | 62-63 | 2 | 5 |
| β-strand | 73-74 | 2 | 4 |
| β-strand | 83-85 | 3 | 4 |
| β-strand | 91-92 | 2 | 3 |
| α-helix | 93-94 | 2 | |
| β-strand | 95-97 | 3 | 2 |
| β-strand | 107-110 | 4 | 6 |
| β-strand | 138-141 | 4 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein afaD | A | protein | 153 | Escherichia coli | Q47038 (AlphaFold model) |
>2FVN_1 Protein afaD (chains A) MRGSHHHHHHGSAELHLESRGGSGTQLRDGAKVATGRIICREAHTGFHVWMNERQVDGRA ERYVVQSKDGRHELRVRTGGDGWSPVKGEGGKGVSRPGQEEQVFFDVMADGNQDIAPGEY RFSVGGACVVPQEDNKQGFTPSGTTGTTKLTVT
The solution structure of the invasive tip complex from Afa/Dr fibrils. Cota, E., Jones, C., Simpson, P. et al. Mol Microbiol (2006) 62:356-366. DOI 10.1111/j.1365-2958.2006.05375.x · PubMed
Other PDB entries of the same protein (UniProt Q47038 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2FVN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.