2AYK: Collagenase

Inhibitor-free catalytic fragment of human fibroblast collagenase, NMR, minimized average structure. Determined by solution NMR. Released 25 Feb 1998.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,247
Mol. weight: 19.04 kDa
Ligands: CA, ZN
Released: 25 Feb 1998

Explore 2AYK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AYK contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
α-helix	27-42	16
β-strand	48-51	4	1
β-strand	59-64	6	1
β-strand	82-84	3	1
β-strand	95-98	4	1
β-strand	104	1	2
β-strand	111	1	2
α-helix	112-123	12
α-helix	150-159	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Collagenase	A	protein	169	Homo sapiens	P03956 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2AYK_1 COLLAGENASE (chains A)
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIM
ISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHEL
GHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQP

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
ZN	Zinc ion	Zn	2

Primary citation

High-resolution solution structure of the inhibitor-free catalytic fragment of human fibroblast collagenase determined by multidimensional NMR. Moy, F.J., Chanda, P.K., Cosmi, S. et al. Biochemistry (1998) 37:1495-1504. DOI 10.1021/bi972181w · PubMed

Other PDB entries of the same protein (UniProt P03956 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HFC 1.5 Å, 1.56 Å structure of mature truncated human fibroblast collagenase
1CGE 1.9 Å, Crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
966C 1.9 Å, Crystal structure of fibroblast collagenase-1 complexed to a diphenyl-ether sulphone…
1CGF 2.1 Å, Crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
1SU3 2.2 Å, X-ray structure of human proMMP-1: New insights into collagenase action
2TCL 2.2 Å, Structure of the catalytic domain of human fibroblast collagenase complexed with an…
3SHI 2.2 Å, Crystal structure of human MMP1 catalytic domain at 2.2 A resolution
1CGL 2.4 Å, Structure of the catalytic domain of fibroblast collagenase complexed with an inhibitor
2J0T 2.54 Å, Crystal Structure of the Catalytic Domain of MMP-1 in Complex with the Inhibitory Domain…
2CLT 2.67 Å, Crystal structure of the active form (full-length) of human fibroblast collagenase.
4AUO 3.0 Å, Crystal structure of MMP-1(E200A) in complex with a triple-helical collagen peptide
1AYK Inhibitor-free catalytic fragment of human fibroblast collagenase, NMR, 30 structures

Browse structure collections

About this viewer

MolViewer shows 2AYK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.