The structure of nucleosome assembly protein suggests a mechanism for histone binding and shuttling. Determined by X-ray diffraction at 3.0 Å resolution. Released 7 Feb 2006.
Explore 2AYU in 3D Show helices and sheets RCSB PDB PDBe
2AYU contains 15 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 77-87 | 11 | |
| α-helix | 90-140 | 51 | |
| α-helix | 144-146 | 3 | |
| α-helix | 147-159 | 13 | |
| α-helix | 163-165 | 3 | |
| α-helix | 188-194 | 7 | |
| α-helix | 199-201 | 3 | |
| α-helix | 205-208 | 4 | |
| α-helix | 210-213 | 4 | |
| β-strand | 214-218 | 5 | 1 |
| β-strand | 221 | 1 | 1 |
| β-strand | 228-235 | 8 | 1 |
| β-strand | 243 | 1 | 2 |
| β-strand | 247-255 | 9 | 1 |
| α-helix | 258-259 | 2 | |
| β-strand | 265-271 | 7 | 1 |
| β-strand | 276 | 1 | 2 |
| β-strand | 285-289 | 5 | 3 |
| β-strand | 304-308 | 5 | 3 |
| α-helix | 312-316 | 5 | |
| α-helix | 332-347 | 16 | |
| α-helix | 348-352 | 5 | |
| α-helix | 356-361 | 6 | |
| α-helix | 363-369 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nucleosome assembly protein | A | protein | 417 | Saccharomyces cerevisiae | P25293 (AlphaFold model) |
>2AYU_1 Nucleosome assembly protein (chains A) MSDPIRTKPKSSMQIDNAPTPHNTPASVLNPSYLKNGNPVRAQAQEQDDKIGTINEEDIL ANQPLLLQSIQDRLGSLVGQDSGYVGGLPKNVKEKLLSLKTLQSELFEVEKEFQVEMFEL ENKFLQKYKPIWEQRSRIISGQEQPKPEQIAKGQEIVESLNETELLVDEEEKAQNDSEEE QVKGIPSFWLTALENLPIVCDTITDRDAEVLEYLQDIGLEYLTDGRPGFKLLFRFDSSAN PFFTNDILCKTYFYQKELGYSGDFIYDHAEGCEISWKDNAHNVTVDLEMRKQRNKTTKQV RTIEKITPIESFFNFFDPPKIQNEDQDEELEEDLEERLALDYSIGEQLKDKLIPRAVDWF TGAALEFEFEEDEEEADEDEDEEEDDDHGLEDDDGESAEEQDDFAGRPEQAPECKQS
The structure of nucleosome assembly protein 1. Park, Y.J., Luger, K. Proc Natl Acad Sci U S A (2006) 103:1248-1253. DOI 10.1073/pnas.0508002103 · PubMed
Other PDB entries of the same protein (UniProt P25293 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2AYU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.