2B4N: Glucose-Dependent Insulinotropic Polypeptide

Solution Structure of Glucose-Dependent Insulinotropic Polypeptide. Determined by solution NMR. Released 2 May 2006.

Method

Solution NMR

Organism

Homo sapiens

Chains

1

Atoms

352

Mol. weight

4.99 kDa

Released

2 May 2006

Explore 2B4N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2B4N contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Molecules and chains

>2B4N_1 Gastric inhibitory polypeptide (chains A)
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Primary citation

NMR and alanine scan studies of glucose-dependent insulinotropic polypeptide in water. Alana, I., Parker, J.C., Gault, V.A. et al. J Biol Chem (2006) 281:16370-16376. DOI 10.1074/jbc.M510414200 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P09681 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 2QKH 1.9 Å, Crystal structure of the extracellular domain of human GIP receptor in complex with the…
• 7DTY 2.98 Å, Structural basis of ligand selectivity conferred by the human glucose-dependent…
• 7RA3 3.24 Å, cryo-EM of human Gastric inhibitory polypeptide receptor GIPR bound to GIP
• 1T5Q Solution Structure of GIP(1-30)amide in TFE/Water
• 2L70 NMR solution structure of GIP in micellular media
• 2L71 NMR solution structure of GIP in Bicellular media
• 2OBU Solution structure of GIP in TFE/water

Browse structure collections

About this viewer

MolViewer shows 2B4N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.