2B5U: Colicin E3 V206C Mutant

Crystal Structure Of Colicin E3 V206C Mutant In Complex With Its Immunity Protein. Determined by X-ray diffraction at 2.3 Å resolution. Released 7 Nov 2006.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Escherichia coli
Chains: 4
Atoms: 8,791
Mol. weight: 136.04 kDa
Ligands: CIT
Released: 7 Nov 2006

Explore 2B5U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2B5U contains 43 α-helices and 70 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	88-89	2	1
β-strand	93-96	4	2
β-strand	99	1	3
β-strand	102	1	3
β-strand	103-108	6	1
α-helix	114-123	10
β-strand	132-139	8	4
α-helix	141-143	3
β-strand	154-160	7	2
α-helix	161-164	4
β-strand	165	1	5
α-helix	169-171	3
β-strand	178-181	4	5
β-strand	184-189	6	4
β-strand	194-200	7	4
β-strand	204-207	4	5
β-strand	208-210	3	2
α-helix	211	1
β-strand	212-213	2	1
β-strand	220-222	3	1
α-helix	228-229	2
β-strand	230-235	6	1
α-helix	244-245	2
β-strand	248-249	2	4
β-strand	257-258	2	4
α-helix	259-260	2
β-strand	267-273	7	2
α-helix	276-278	3
α-helix	280-282	3
β-strand	283-289	7	2
α-helix	293-313	21
α-helix	315-375	61
α-helix	376-378	3
α-helix	386-448	63
α-helix	457-460	4
α-helix	465-469	5
α-helix	470-472	3
β-strand	480-482	3	6
β-strand	487	1	7
α-helix	488	1
β-strand	494	1	7
β-strand	497-500	4	6
β-strand	505-510	6	6
β-strand	515-520	6	6
β-strand	525	1	8
β-strand	526-530	5	6
β-strand	537-539	3	6
β-strand	546	1	8
α-helix	548-550	3

Chains B and D: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	7
β-strand	16-21	6	7
α-helix	30-35	6
β-strand	43	1	7
β-strand	47-49	3	7
α-helix	52-54	3
α-helix	55-58	4
α-helix	59-61	3
β-strand	71-79	9	7

Chain C: 16 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	88-89	2	9
β-strand	94-96	3	10
β-strand	99	1	11
β-strand	102	1	11
β-strand	103-108	6	9
α-helix	114-123	10
β-strand	132-139	8	12
α-helix	141-143	3
β-strand	154-160	7	10
α-helix	161-163	3
β-strand	165	1	13
β-strand	178-181	4	13
β-strand	184-190	7	12
β-strand	193-200	8	12
β-strand	204-207	4	13
β-strand	208-210	3	10
β-strand	212-213	2	9
β-strand	220-222	3	9
α-helix	228-229	2
β-strand	230-235	6	9
α-helix	244-245	2
β-strand	248-249	2	12
β-strand	257-258	2	12
α-helix	259-260	2
β-strand	267-273	7	10
α-helix	280-282	3
β-strand	283-289	7	10
α-helix	293-312	20
α-helix	315-374	60
α-helix	376-378	3
α-helix	386-449	64
α-helix	457-460	4
α-helix	465-469	5
α-helix	470-472	3
β-strand	480-482	3	14
β-strand	487	1	15
α-helix	488	1
β-strand	494	1	15
β-strand	497-500	4	14
β-strand	505-510	6	14
β-strand	515-520	6	14
β-strand	525	1	16
β-strand	526-530	5	14
β-strand	537-539	3	14
β-strand	546	1	16
α-helix	548-550	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Colicin E3	A, C	protein	551	Escherichia coli	P00646 (AlphaFold model)
Colicin E3 immunity protein	B, D	protein	84	Escherichia coli	P02984 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2B5U_1 Colicin E3 (chains A, C)
MSGGDGRGHNTGAHSTSGNINGGPTGLGVGGGASDGSGWSSENNPWGGGSGSGIHWGGGS
GHGNGGGNGNSGGGSGTGGNLSAVAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIM
AALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVN
VNVRVVDDVKDERQNISVVSGVPMSCPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPA
VQTLSPGVTNNTDKDVRPAGFTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQ
DEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDA
ANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSD
ADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLK
PGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKG
PDPKRNIKKYL

Sequence of entity 2 (B, D), FASTA

>2B5U_2 Colicin E3 immunity protein (chains B, D)
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQP
YFNHQIDISDNEYFVSFDYRDGDW

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	2

Primary citation

Crystal Structure Of Colicin E3 In Complex With Its Immunity Protein. Nallini Vijayarangan, A., Nithianantham, S., Nan, W. et al. To be published.

Other PDB entries of the same protein (UniProt P00646 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1E44 2.4 Å, ribonuclease domain of colicin E3 in complex with its immunity protein
1UJW 2.75 Å, Structure of the complex between BtuB and Colicin E3 Receptor binding domain
4UDM 2.96 Å, Crystal structure of Im3 in complex with Y52A mutant of E3RNase
1JCH 3.02 Å, Crystal Structure of Colicin E3 in Complex with its Immunity Protein
4V5K 3.2 Å, Structure of cytotoxic domain of colicin E3 bound to the 70S ribosome

Browse structure collections

About this viewer

MolViewer shows 2B5U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.