1E44: Ribonuclease domain of colicin E3

Name: PDB 1E44: ribonuclease domain of colicin E3 in complex with its immunity protein
Published: 2001-06-28
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribonuclease

ribonuclease domain of colicin E3 in complex with its immunity protein. Determined by X-ray diffraction at 2.4 Å resolution. Released 28 Jun 2001.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: ESCHERICHIA COLI
Chains: 2
Atoms: 1,633
Mol. weight: 20.78 kDa
Released: 28 Jun 2001

Explore 1E44 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1E44 contains 10 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	1
β-strand	16-21	6	1
α-helix	22-24	3
α-helix	30-35	6
β-strand	47-49	3	1
α-helix	54-58	5
α-helix	59-61	3
β-strand	71-79	9	1

Chain B: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5
α-helix	10-14	5
α-helix	15-17	3
β-strand	24-27	4	2
β-strand	32	1	1
α-helix	38	1
β-strand	39	1	1
α-helix	40-41	2
β-strand	42-45	4	2
β-strand	50-55	6	2
β-strand	60-65	6	2
β-strand	70	1	3
β-strand	71-75	5	2
β-strand	82	1	2
β-strand	91	1	3
α-helix	93-95	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunity protein	A	protein	85	ESCHERICHIA COLI	P02984 (AlphaFold model)
Colicin E3	B	protein	96	ESCHERICHIA COLI	P00646 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1E44_1 IMMUNITY PROTEIN (chains A)
MGLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQ
PYFNHQIDISDNEYFVSFDYRDGDW

Sequence of entity 2 (B), FASTA

>1E44_2 COLICIN E3 (chains B)
GFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGE
LEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL

Primary citation

Inhibition of a Ribosome Inactivating Ribonuclease: The Crystal Structure of the Cytotoxic Domain of Colicin E3 in Complex with its Immunity Protein. Carr, S., Walker, D., James, R. et al. Structure (2000) 8:949. DOI 10.1016/S0969-2126(00)00186-6 · PubMed

Other PDB entries of the same protein (UniProt P02984 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EIP 1.8 Å, Crystal structure of colicin E3 immunity protein: an inhibitor to a…
2B5U 2.3 Å, Crystal Structure Of Colicin E3 V206C Mutant In Complex With Its Immunity Protein
4UDM 2.96 Å, Crystal structure of Im3 in complex with Y52A mutant of E3RNase
1JCH 3.02 Å, Crystal Structure of Colicin E3 in Complex with its Immunity Protein

Browse structure collections

About this viewer

MolViewer shows 1E44 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.