2B9R: Human Cyclin B1

Name: PDB 2B9R: Crystal Structure of Human Cyclin B1
Published: 2006-10-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cell cycle

Crystal Structure of Human Cyclin B1. Determined by X-ray diffraction at 2.9 Å resolution. Released 17 Oct 2006.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,030
Mol. weight: 61.68 kDa
Released: 17 Oct 2006

Explore 2B9R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2B9R contains 38 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 0 β-strands

Element	Residues	Length
α-helix	14-19	6
α-helix	35-51	17
α-helix	56-70	15
α-helix	77-79	3
α-helix	80-95	16
α-helix	99-101	3
α-helix	102-108	7
α-helix	115-128	14
α-helix	138-147	10
α-helix	153-165	13
α-helix	166-168	3
α-helix	170-172	3
α-helix	176	1
α-helix	179-192	14
α-helix	201-204	4
α-helix	215-225	11
α-helix	235-239	5
α-helix	243-245	3
α-helix	248-250	3
α-helix	256-258	3

Chain B: 18 helices, 0 β-strands

Element	Residues	Length
α-helix	10-21	12
α-helix	35-51	17
α-helix	56-70	15
α-helix	77-95	19
α-helix	99-101	3
α-helix	102-108	7
α-helix	115-128	14
α-helix	138-147	10
α-helix	153-165	13
α-helix	166-168	3
α-helix	170-172	3
α-helix	179-188	10
α-helix	189-193	5
α-helix	199-204	6
α-helix	209-226	18
α-helix	235-239	5
α-helix	243-245	3
α-helix	248-250	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human cyclin B1	A, B	protein	269	Homo sapiens	P14635 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2B9R_1 Human cyclin B1 (chains A, B)
NLSSEYVKDIYAYLRQLEAAQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMY
MTVSIIDRFMQNNSVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQ
MEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQI
AAGAFSLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKY
ATSKHAKISTLPQLNSALVQDLAKAVAKV

Primary citation

The Crystal Structure of Human Cyclin B. Petri, E.T., Errico, A., Escobedo, L. et al. Cell Cycle (2007) 6:1342-1349. PubMed

Other PDB entries of the same protein (UniProt P14635 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GU2 2.0 Å, CDK1/CyclinB/Cks2 in complex with Flavopiridol
5LQF 2.06 Å, CDK1/CyclinB1/CKS2 in complex with NU6102
9Q3N 2.1 Å, Crystal structure of human CDK5-cyclinB1 complex
4Y72 2.3 Å, Human CDK1/CyclinB1/CKS2 With Inhibitor
5HQ0 2.3 Å, Ternary complex of human proteins CDK1, Cyclin B and CKS2, bound to an inhibitor
11GY 2.4 Å, Crystal structure of selective inhibitor 16 bound at the active site of CDK1
9FH9 2.5 Å, Structure of CyclinB1 N-terminus bound to the NCP
9Q3O 2.5 Å, Crystal structure of human CDK5-cyclinB1 complex bound to AMP-PNP
6GU3 2.65 Å, CDK1/CyclinB/Cks2 in complex with AZD5438
4YC3 2.7 Å, CDK1/CyclinB1/CKS2 Apo
6GU4 2.73 Å, CDK1/CyclinB/Cks2 in complex with CGP74514A
2JGZ 2.9 Å, Crystal structure of phospho-CDK2 in complex with Cyclin B

Browse structure collections

About this viewer

MolViewer shows 2B9R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.