DNA polymerase lambda in complex with a DNA duplex containing an unpaired Damp. Determined by X-ray diffraction at 1.75 Å resolution. Released 7 Mar 2006.
Explore 2BCR in 3D Show helices and sheets RCSB PDB PDBe
2BCR contains 19 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 254-269 | 16 | |
| α-helix | 273-286 | 14 | |
| α-helix | 296-300 | 5 | |
| α-helix | 307-317 | 11 | |
| α-helix | 323-326 | 4 | |
| α-helix | 332-339 | 8 | |
| α-helix | 346-354 | 9 | |
| α-helix | 360-366 | 7 | |
| α-helix | 371-378 | 8 | |
| α-helix | 382-384 | 3 | |
| β-strand | 387-388 | 2 | 1 |
| α-helix | 389-406 | 18 | |
| β-strand | 411-414 | 4 | 2 |
| α-helix | 416-419 | 4 | |
| β-strand | 424-425 | 2 | 1 |
| β-strand | 428-433 | 6 | 2 |
| α-helix | 444-453 | 10 | |
| β-strand | 457-462 | 6 | 2 |
| β-strand | 472-477 | 6 | 2 |
| β-strand | 487-493 | 7 | 2 |
| α-helix | 496-498 | 3 | |
| α-helix | 499-507 | 9 | |
| α-helix | 510-522 | 13 | |
| β-strand | 526-527 | 2 | 3 |
| β-strand | 532-534 | 3 | 3 |
| β-strand | 537-538 | 2 | 4 |
| β-strand | 544-546 | 3 | 4 |
| β-strand | 549-550 | 2 | 3 |
| α-helix | 551-552 | 2 | |
| α-helix | 556-562 | 7 | |
| α-helix | 570-573 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5'-d(p*gp*cp*cp*g)-3' | D | DNA | 4 | ||
| 5'-d(*cp*ap*gp*tp*ap*cp*g)-3' | P | DNA | 7 | ||
| 5'-d(*cp*gp*gp*cp*cp*gp*ap*tp*ap*cp*tp*g)-3' | T | DNA | 12 | ||
| DNA polymerase lambda | A | protein | 335 | Homo sapiens | Q9UGP5 (AlphaFold model) |
>2BCR_1 5'-D(P*GP*CP*CP*G)-3' (chains D) GCCG
>2BCR_2 5'-D(*CP*AP*GP*TP*AP*CP*G)-3' (chains P) CAGTACG
>2BCR_3 5'-D(*CP*GP*GP*CP*CP*GP*AP*TP*AP*CP*TP*G)-3' (chains T) CGGCCGATACTG
>2BCR_4 DNA polymerase lambda (chains A) MAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEAC SIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSL EDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLP GPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNT HGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
Water and common crystallization additives (EDO, NA) are not listed.
Structural analysis of strand misalignment during DNA synthesis by a human DNA polymerase. Garcia-Diaz, M., Bebenek, K., Krahn, J.M. et al. Cell (2006) 124:331-342. DOI 10.1016/j.cell.2005.10.039 · PubMed
Other PDB entries of the same protein (UniProt Q9UGP5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2BCR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.