Crystal structure of the pre-catalytic ternary complex of DNA polymerase lambda with a templating 8-oxo-dG and an incoming dATP. Determined by X-ray diffraction at 1.8 Å resolution. Released 17 Aug 2016.
Explore 5III in 3D Show helices and sheets RCSB PDB PDBe
5III contains 20 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 256-269 | 14 | |
| α-helix | 273-287 | 15 | |
| α-helix | 292-293 | 2 | |
| α-helix | 296-301 | 6 | |
| α-helix | 307-317 | 11 | |
| α-helix | 323-327 | 5 | |
| α-helix | 332-339 | 8 | |
| α-helix | 346-354 | 9 | |
| α-helix | 360-366 | 7 | |
| α-helix | 371-378 | 8 | |
| α-helix | 380-384 | 5 | |
| β-strand | 387-388 | 2 | 1 |
| α-helix | 389-406 | 18 | |
| β-strand | 411-414 | 4 | 2 |
| α-helix | 416-419 | 4 | |
| β-strand | 424-425 | 2 | 1 |
| β-strand | 428-433 | 6 | 2 |
| α-helix | 444-453 | 10 | |
| β-strand | 457-462 | 6 | 2 |
| β-strand | 472-477 | 6 | 2 |
| β-strand | 487-493 | 7 | 2 |
| α-helix | 496-498 | 3 | |
| α-helix | 499-507 | 9 | |
| α-helix | 510-522 | 13 | |
| β-strand | 526-527 | 2 | 3 |
| β-strand | 532-533 | 2 | 3 |
| β-strand | 550 | 1 | 3 |
| α-helix | 551-552 | 2 | |
| α-helix | 556-562 | 7 | |
| α-helix | 570-573 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA polymerase lambda | A | protein | 334 | Homo sapiens | Q9UGP5 (AlphaFold model) |
| DNA (5'-d(p*gp*cp*cp*g)-3') | D | DNA | 4 | synthetic construct | |
| DNA (5'-d(*cp*ap*gp*tp*ap*(doc))-3') | P | DNA | 6 | synthetic construct | |
| DNA (5'-D(*CP*GP*GP*CP*(8OG)P*GP*TP*AP*CP*TP*G)-3') | T | DNA | 11 | synthetic construct |
>5III_1 DNA polymerase lambda (chains A) AQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACS IPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLE DIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRRG KATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPG PGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTH GCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
>5III_2 DNA (5'-D(P*GP*CP*CP*G)-3') (chains D) GCCG
>5III_3 DNA (5'-D(*CP*AP*GP*TP*AP*(DOC))-3') (chains P) CAGTAC
>5III_4 DNA (5'-D(*CP*GP*GP*CP*(8OG)P*GP*TP*AP*CP*TP*G)-3') (chains T) CGGCGGTACTG
Water and common crystallization additives (NA) are not listed.
A fidelity mechanism in DNA polymerase lambda promotes error-free bypass of 8-oxo-dG. Burak, M.J., Guja, K.E., Hambardjieva, E. et al. EMBO J (2016) 35:2045-2059. DOI 10.15252/embj.201694332 · PubMed
Other PDB entries of the same protein (UniProt Q9UGP5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5III directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.