2BCT: Beta-catenin

The armadillo repeat region from murine beta-catenin. Determined by X-ray diffraction at 2.9 Å resolution. Released 15 Oct 1997.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Mus musculus
Chains: 1
Atoms: 3,820
Mol. weight: 56.31 kDa
Released: 15 Oct 1997

Explore 2BCT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BCT contains 36 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 0 β-strands

Element	Residues	Length
α-helix	152-160	9
α-helix	165-178	14
α-helix	182-189	8
α-helix	192-204	13
α-helix	208-222	15
α-helix	225-232	8
α-helix	236-242	7
α-helix	243-245	3
α-helix	249-265	17
α-helix	269-275	7
α-helix	278-285	8
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-330	11
α-helix	334-347	14
α-helix	353-359	7
α-helix	362-366	5
α-helix	367-369	3
α-helix	375-389	15
α-helix	398-408	11
α-helix	414-428	15
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	490-496	7
α-helix	504-519	16
α-helix	521-530	10
α-helix	532-545	14
α-helix	566-580	15
α-helix	584-592	9
α-helix	596-602	7
α-helix	608-621	14
α-helix	625-633	9
α-helix	637-641	5
α-helix	649-661	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-catenin	A	protein	516	Mus musculus	Q02248 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BCT_1 BETA-CATENIN (chains A)
TRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVE
TARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGA
KMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMR
TYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLS
DAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVR
TVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKA
TVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEI
VEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAE
AIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSED

Primary citation

Three-dimensional structure of the armadillo repeat region of beta-catenin. Huber, A.H., Nelson, W.J., Weis, W.I. Cell (1997) 90:871-882. DOI 10.1016/S0092-8674(00)80352-9 · PubMed

Other PDB entries of the same protein (UniProt Q02248 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DOW 1.8 Å, Crystal structure of a chimera of beta-catenin and alpha-catenin
4EV8 1.9 Å, Crystal structure of mouse catenin beta-59 in 2.4M urea.
1I7W 2.0 Å, Beta-catenin/phosphorylated E-cadherin complex
4EVA 2.0 Å, Crystal Structure of Mouse Catenin beta-59 in 5.6M urea
1M1E 2.1 Å, Beta-catenin armadillo repeat domain bound to ICAT
1V18 2.1 Å, The crystal structure of beta-catenin armadillo repeat complexed with a phosphorylated…
3BCT 2.1 Å, The armadillo repeat region from murine beta-catenin
4EV9 2.1 Å, Crystal Structure of Mouse Catenin beta-59 in 4.0M urea
4EVP 2.25 Å, Crystal Structure of Mouse Catenin beta-59 in 7.2M urea
4EVT 2.34 Å, Crystal Structure of Mouse Catenin beta-59 in 8.3M urea
3OUX 2.4 Å, Structure of beta-catenin with phosphorylated Lef-1
4ONS 2.8 Å, Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin…

Browse structure collections

About this viewer

MolViewer shows 2BCT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.