Crystal structure of basic fibroblast growth factor at 1.6 Å resolution. Determined by X-ray diffraction at 2.5 Å resolution. Released 31 Jan 1994.
Explore 2BFH in 3D Show helices and sheets RCSB PDB PDBe
2BFH contains 5 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-25 | 5 | 1 |
| β-strand | 30-34 | 5 | 1 |
| β-strand | 40-43 | 4 | 1 |
| α-helix | 49-51 | 3 | |
| β-strand | 53-57 | 5 | 1 |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 72-76 | 5 | 1 |
| β-strand | 82-85 | 4 | 1 |
| α-helix | 90-92 | 3 | |
| β-strand | 94-98 | 5 | 1 |
| β-strand | 104-108 | 5 | 1 |
| β-strand | 115 | 1 | 1 |
| β-strand | 118 | 1 | 2 |
| β-strand | 123 | 1 | 1 |
| β-strand | 124 | 1 | 2 |
| α-helix | 125-126 | 2 | |
| α-helix | 127-129 | 3 | |
| α-helix | 135-137 | 3 | |
| β-strand | 139-143 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Basic fibroblast growth factor | A | protein | 128 | Homo sapiens | P09038 (AlphaFold model) |
>2BFH_1 BASIC FIBROBLAST GROWTH FACTOR (chains A) DPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKE DGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAIL FLPMSAKS
Crystal structure of basic fibroblast growth factor at 1.6 A resolution. Ago, H., Kitagawa, Y., Fujishima, A. et al. J Biochem (1991) 110:360-363. PubMed
Other PDB entries of the same protein (UniProt P09038 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2BFH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.