2BFW: Glga glycogen synthase

Structure of the C domain of glycogen synthase from Pyrococcus abyssi. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Nov 2005.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: PYROCOCCUS ABYSSI
Chains: 1
Atoms: 1,866
Mol. weight: 22.75 kDa
Released: 28 Nov 2005

Explore 2BFW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BFW contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	226-228	3
α-helix	233-243	11
β-strand	250-255	6	1
β-strand	258	1	2
α-helix	265-275	11
α-helix	279-283	5
β-strand	284-289	6	1
β-strand	292	1	2
α-helix	294-306	13
β-strand	310-313	4	1
α-helix	319-326	8
β-strand	331-334	4	1
α-helix	343-350	8
α-helix	353	1
β-strand	354-358	5	1
α-helix	361-366	6
β-strand	373-375	3	1
α-helix	380-391	12
α-helix	395-411	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glga glycogen synthase	A	protein	200	PYROCOCCUS ABYSSI	Q9V2J8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BFW_1 GLGA GLYCOGEN SYNTHASE (chains A)
GSHNGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIE
ILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVI
IPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALEL
SRSDLSKFRENCKKRAMSFS

Primary citation

Crystal Structure of an Archaeal Glycogen Synthase: Insights Into Oligomerisation and Substrate Binding of Eukaryotic Glycogen Synthases. Horcajada, C., Guinovart, J.J., Fita, I. et al. J Biol Chem (2006) 281:2923. DOI 10.1074/JBC.M507394200 · PubMed

Other PDB entries of the same protein (UniProt Q9V2J8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WQC 1.96 Å, Crystal structure of human orexin 2 receptor bound to the selective antagonist EMPA…
6HLP 2.2 Å, Crystal structure of the Neurokinin 1 receptor in complex with the small molecule…
5WS3 2.3 Å, Crystal structures of human orexin 2 receptor bound to the selective antagonist EMPA…
6HLO 2.4 Å, Crystal structure of the Neurokinin 1 receptor in complex with the small molecule…
3FRO 2.5 Å, Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed…
4S0V 2.5 Å, Crystal structure of the human OX2 orexin receptor bound to the insomnia drug Suvorexant
6FJ3 2.5 Å, High resolution crystal structure of parathyroid hormone 1 receptor in complex with a…
3L01 2.6 Å, Crystal structure of monomeric glycogen synthase from Pyrococcus abyssi
5U09 2.6 Å, High-resolution crystal structure of the human CB1 cannabinoid receptor
6TPN 2.61 Å, Crystal structure of the Orexin-2 receptor in complex with HTL6641 at 2.61 A resolution
7FEE 2.7 Å, Crystal structure of the allosteric modulator ZCZ011 binding to CP55940-bound…
6TPJ 2.74 Å, Crystal structure of the Orexin-2 receptor in complex with suvorexant at 2.76 A resolution

Browse structure collections

About this viewer

MolViewer shows 2BFW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.