5U09: Human CB1 cannabinoid receptor

High-resolution crystal structure of the human CB1 cannabinoid receptor. Determined by X-ray diffraction at 2.6 Å resolution. Released 7 Dec 2016.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Homo sapiens, Pyrococcus abyssi (strain GE5 / Orsay)
Chains: 1
Atoms: 3,943
Mol. weight: 59.25 kDa
Ligands: 7DY
Released: 7 Dec 2016

Explore 5U09 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5U09 contains 27 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	105-107	3
α-helix	113-143	31
α-helix	145-148	4
α-helix	151-153	3
α-helix	154-178	25
α-helix	186-219	34
α-helix	224-227	4
α-helix	230-249	20
α-helix	250-253	4
α-helix	257-260	4
α-helix	263	1
β-strand	264	1	1
α-helix	265	1
β-strand	272	1	1
α-helix	273-300	28
α-helix	1009-1011	3
α-helix	1016-1026	11
β-strand	1033-1038	6	2
β-strand	1041	1	3
β-strand	1046	1	4
α-helix	1048-1059	12
α-helix	1063-1066	4
β-strand	1067-1072	6	2
β-strand	1075	1	3
α-helix	1077-1089	13
β-strand	1093-1096	4	2
α-helix	1099-1101	3
α-helix	1102-1109	8
β-strand	1114-1117	4	2
β-strand	1119	1	4
α-helix	1126-1133	8
α-helix	1136	1
β-strand	1137-1141	5	2
α-helix	1146-1149	4
β-strand	1156-1158	3	2
α-helix	1163-1176	14
α-helix	1182-367	50
α-helix	375-400	26
α-helix	402-409	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cannabinoid receptor 1,GlgA glycogen synthase	A	protein	508	Homo sapiens, Pyrococcus abyssi (strain GE5 / Orsay)	P21554 (AlphaFold model), Q9V2J8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5U09_1 Cannabinoid receptor 1,GlgA glycogen synthase (chains A)
GKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLR
CRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLF
LAAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIF
PHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAGIDCSFWNESYLTGSRDERKKSLLSKF
GMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLE
EKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLR
DIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSDQARMDIRLAK
TLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKD
LRHAFRSMFPSCEGTAQPHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
7DY	N-[(2S,3S)-4-(4-chlorophenyl)-3-(3-cyanophenyl)butan-2-yl]-2-methyl-2-{[5-(trif…	C27 H25 Cl F3 N3 O2	1

Water and common crystallization additives (SO4, PEG) are not listed.

Primary citation

High-resolution crystal structure of the human CB1 cannabinoid receptor. Shao, Z., Yin, J., Chapman, K. et al. Nature (2016). DOI 10.1038/nature20613 · PubMed

Other PDB entries of the same protein (UniProt P21554 (AlphaFold model), which also has an AlphaFold model), best resolution first:

23IV 2.42 Å, Cannabinoid Receptor 1-Gi Complex
23IW 2.42 Å, Cannabinoid Receptor 1-Gi Complex
7FEE 2.7 Å, Crystal structure of the allosteric modulator ZCZ011 binding to CP55940-bound…
5TGZ 2.8 Å, Crystal Structure of the Human Cannabinoid Receptor CB1
5XRA 2.8 Å, Crystal structure of the human CB1 in complex with agonist AM11542
8GHV 2.8 Å, Cannabinoid Receptor 1-G Protein Complex
9B54 2.86 Å, Biased agonist bound CB1-Gi structure
8K8J 2.88 Å, Cannabinoid Receptor 1 bound to Fenofibrate coupling MiniGsq and Nb35 Complex
9ERX 2.9 Å, Structural basis of D9-THC analog activity at the Cannabinoid 1 receptor
5XR8 2.95 Å, Crystal structure of the human CB1 in complex with agonist AM841
6KPG 3.0 Å, Cryo-EM structure of CB1-G protein complex
6N4B 3.0 Å, Cannabinoid Receptor 1-G Protein Complex

Browse structure collections

About this viewer

MolViewer shows 5U09 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.