2BH8: Combinatorial Protein 1b11

Combinatorial Protein 1b11. Determined by X-ray diffraction at 1.9 Å resolution. Released 7 Feb 2005.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: ESCHERICHIA COLI
Chains: 2
Atoms: 1,403
Mol. weight: 21.48 kDa
Released: 7 Feb 2005

Explore 2BH8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BH8 contains 6 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	19-27	9	1
α-helix	28-30	3
β-strand	32-37	6	1
β-strand	43-47	5	1
α-helix	56-57	2
α-helix	59-61	3
β-strand	66-73	8	1
β-strand	77-81	5	2
β-strand	87-98	12	2
α-helix	99-101	3

Chain B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-27	11	2
β-strand	32-37	6	2
β-strand	43-47	5	2
α-helix	50-53	4
α-helix	59-62	4
β-strand	66-73	8	2
β-strand	77-81	5	1
β-strand	87-98	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
1B11	A, B	protein	101	ESCHERICHIA COLI	P0AG67 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2BH8_1 1B11 (chains A, B)
MRGSHHHHGSRLQSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAGSSGAAVRGNPQ
QGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWAQAEA

Primary citation

A Segment of Cold Shock Protein Directs the Folding of a Combinatorial Protein. De Bono, S., Riechmann, L., Girard, E. et al. Proc Natl Acad Sci U S A (2005) 102:1396. DOI 10.1073/PNAS.0407298102 · PubMed

Other PDB entries of the same protein (UniProt P0AG67 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GUU 2.5 Å, 30S mRNA delivery complex (consensus)
9IOT 2.7 Å, Cryo-EM structure of Escherichia coli hibernating ribosome with RNase I mutant
9GUP 2.8 Å, 30S mRNA delivery complex (open head)
9GUT 2.8 Å, 30S mRNA delivery complex (bS1 resolved)
4Q7J 2.9 Å, Complex structure of viral RNA polymerase
6H4N 3.0 Å, Structure of a hibernating 100S ribosome reveals an inactive conformation of the…
9GUV 3.0 Å, 30S mRNA delivery complex (closed-head)
6X7K 3.1 Å, Cryo-EM structure of an Escherichia coli coupled transcription-translation complex B3…
8URY 3.1 Å, Escherichia coli transcription-translation coupled complex class B (TTC-B) containing…
9GUQ 3.1 Å, 30S PIC (Pre-Initiation complex)
9GUW 3.1 Å, 30S-TEC (TEC in expressome position) Inactive state 2
6X6T 3.2 Å, Cryo-EM structure of an Escherichia coli coupled transcription-translation complex B1…

Browse structure collections

About this viewer

MolViewer shows 2BH8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.