Crystal Structure of the FHA Domain of Human Polynucleotide Kinase 3' Phosphatase. Determined by X-ray diffraction at 1.4 Å resolution. Released 9 May 2005.
Explore 2BRF in 3D Show helices and sheets RCSB PDB PDBe
2BRF contains 3 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| α-helix | 14 | 1 | |
| β-strand | 22-23 | 2 | 1 |
| α-helix | 24-25 | 2 | |
| β-strand | 31-33 | 3 | 2 |
| β-strand | 36 | 1 | 3 |
| β-strand | 41 | 1 | 3 |
| β-strand | 51-56 | 6 | 2 |
| β-strand | 61-66 | 6 | 2 |
| α-helix | 71-72 | 2 | |
| β-strand | 73-74 | 2 | 1 |
| β-strand | 78 | 1 | 1 |
| β-strand | 84-88 | 5 | 2 |
| β-strand | 92-96 | 5 | 1 |
| β-strand | 99-107 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bifunctional polynucleotide phosphatase/kinase | A | protein | 110 | HOMO SAPIENS | Q96T60 (AlphaFold model) |
>2BRF_1 BIFUNCTIONAL POLYNUCLEOTIDE PHOSPHATASE/KINASE (chains A) MGEVEAPGRLWLESPPGEAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETR TVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETR
Specific Recognition of a Multiply Phosphorylated Motif in the DNA Repair Scaffold Xrcc1 by the Fha Domain of Human Pnk. Ali, A.A.E., Jukes, R.M., Pearl, L.H. et al. Nucleic Acids Res (2009) 37:1701. DOI 10.1093/NAR/GKN1086 · PubMed
Other PDB entries of the same protein (UniProt Q96T60 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2BRF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.