2BVR: Human thrombin

Human thrombin complexed with fragment-based small molecules occupying the S1 pocket. Determined by X-ray diffraction at 1.25 Å resolution. Released 25 Oct 2006.

Method: X-ray diffraction
Resolution: 1.25 Å
Organisms: HOMO SAPIENS, HIRUDO MEDICINALIS
Chains: 3
Atoms: 2,814
Mol. weight: 34.93 kDa
Ligands: 4CP
Released: 25 Oct 2006

Explore 2BVR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BVR contains 15 α-helices and 23 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	39-46	8	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	60-60A	2	4
α-helix	60B-60D	3
β-strand	60F-60G	2	4
α-helix	61-63	3
β-strand	64-68	5	3
β-strand	72	1	5
β-strand	81-83	3	3
β-strand	85-90	6	3
β-strand	95	1	6
β-strand	100	1	6
β-strand	104-108	5	3
α-helix	111-114	4
α-helix	120-121	2
β-strand	122	1	2
α-helix	126-129C	7
β-strand	135-140	6	2
β-strand	154	1	5
β-strand	156-162	7	2
α-helix	165-170	6
α-helix	175-176	2
β-strand	180-183	4	2
α-helix	186-186B	3
β-strand	189	1	1
β-strand	198-202	5	2
β-strand	207-215	9	2
β-strand	226-230	5	2
α-helix	232-234	3
α-helix	235-244	10

Chain I: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	12-13	2

Chain L: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	14C-14I	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha thrombin	H	protein	252	HOMO SAPIENS	P00734 (AlphaFold model)
Hirudin variant-2	I	protein	11	HIRUDO MEDICINALIS	P09945 (AlphaFold model)
Alpha thrombin	L	protein	36	HOMO SAPIENS	P00734 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>2BVR_1 ALPHA THROMBIN (chains H)
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLL
VRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCL
PDRETAASLLQAGYKGRVTGWGNLKEKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFC
AGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLK
KWIQKVIDQFGE

Sequence of entity 2 (I), FASTA

>2BVR_2 HIRUDIN VARIANT-2 (chains I)
GDFEEIPEEYA

Sequence of entity 3 (L), FASTA

>2BVR_3 ALPHA THROMBIN (chains L)
TFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGR

Ligands and cofactors

ID	Name	Formula	Copies
4CP	2-[2-(4-chloro-phenylsulfanyl)-acetylamino]-3-(4-guanidino-phenyl)-propionamide	C18 H20 Cl N5 O2 S	1

Primary citation

Discovery of Thrombin Inhibitor Fragments from Chemical Microarray Screening. Neumann, T., Junker, H.-D., Keil, O. et al. Lett Drug Des Discov (2005) 2:590-594. DOI 10.2174/157018005774717343

Other PDB entries of the same protein (UniProt P00734 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AFY 1.12 Å, Thrombin in complex with 3-chloro-benzamide
4UD9 1.12 Å, Thrombin in complex with 5-chlorothiophene-2-carboxamide
4UE7 1.13 Å, Thrombin in complex with 1-amidinopiperidine
4UDW 1.16 Å, Thrombin in complex with 1-(2R)-2-amino-3-phenyl-propanoyl-N-(2,…
4UEH 1.16 Å, Thrombin in complex with benzamidine
5AF9 1.18 Å, Thrombin in complex with 4-Methoxy-N-(2-pyridinyl)benzamide
3RM2 1.23 Å, Human Thrombin in complex with MI003
5AHG 1.24 Å, Thrombin in complex with ((4-chlorophenyl)sulfamoyl))diemethylamine
3VXE 1.25 Å, Human alpha-thrombin-Bivalirudin complex at PD5.0
2UUF 1.26 Å, Thrombin-hirugen binary complex at 1.26A resolution
3SI4 1.27 Å, Human Thrombin In Complex With UBTHR104
5JZY 1.27 Å, Thrombin in complex with (S)-1-((R)-2-amino-3-cyclohexylpropanoyl)-N-(4-carbamimidoylbenz…

Browse structure collections

About this viewer

MolViewer shows 2BVR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.