2BZL: PDB entry 2BZL

Crystal structure of the human protein tyrosine phosphatase N14 at 1. 65 a resolution. Determined by X-ray diffraction at 1.65 Å resolution. Released 13 Sept 2005.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,534
Mol. weight: 37.94 kDa
Released: 13 Sept 2005

Explore 2BZL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BZL contains 13 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	896-903	8
α-helix	909-914	6
α-helix	931-934	4
α-helix	946-948	3
β-strand	949	1	1
α-helix	950-954	5
β-strand	965-972	8	1
β-strand	975-982	8	1
α-helix	983-986	4
α-helix	990-999	10
β-strand	1004-1007	4	1
β-strand	1012-1013	2	2
β-strand	1016-1017	2	2
β-strand	1032-1035	4	1
β-strand	1038-1047	10	1
β-strand	1051-1060	10	1
β-strand	1066-1074	9	1
α-helix	1086-1103	18
α-helix	1105-1107	3
α-helix	1112-1116	5
β-strand	1117-1120	4	1
α-helix	1126-1142	17
α-helix	1149-1157	9
α-helix	1167-1183	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase, non-receptor type 14	A	protein	325	HOMO SAPIENS	Q15678 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BZL_1 TYROSINE-PROTEIN PHOSPHATASE, NON-RECEPTOR TYPE 14 (chains A)
MHHHHHHSSGVDLGTENLYFQSMVDATRVPMDERFRTLKKKLEEGMVFTEYEQIPKKKAN
GIFSTAALPENAERSRIREVVPYEENRVELIPTKENNTGYINASHIKVVVGGAEWHYIAT
QGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTT
KFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRH
TNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYCLEHNEKVEVPMMLRLLREQRMF
MIQTIAQYKFVYQVLIQFLQNSRLI

Primary citation

Crystal Structure of Human Protein Tyrosine Phosphatase 14 (Ptpn14) at 1.65-A Resolution. Barr, A.J., Debreczeni, J.E., Eswaran, J. et al. Proteins (2006) 63:1132. DOI 10.1002/PROT.20958 · PubMed

Other PDB entries of the same protein (UniProt Q15678 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6IWD 1.8 Å, The PTP domain of human PTPN14 in a complex with the CR3 domain of HPV18 E7
6JJW 2.4 Å, Crystal Structure of KIBRA and PTPN14 complex

Browse structure collections

About this viewer

MolViewer shows 2BZL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.