6IWD: PDB entry 6IWD

Name: PDB 6IWD: The PTP domain of human PTPN14 in a complex with the CR3 domain of HPV18 E7
Published: 2019-07-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: oncoprotein

The PTP domain of human PTPN14 in a complex with the CR3 domain of HPV18 E7. Determined by X-ray diffraction at 1.8 Å resolution. Released 31 Jul 2019.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, Human papillomavirus type 18
Chains: 2
Atoms: 2,968
Mol. weight: 41.64 kDa
Ligands: ZN, PO4
Released: 31 Jul 2019

Explore 6IWD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IWD contains 17 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	894-905	12
α-helix	909-914	6
α-helix	926-929	4
α-helix	931-936	6
α-helix	946-948	3
β-strand	949-951	3	1
α-helix	952-954	3
β-strand	962-972	11	1
β-strand	975-982	8	1
α-helix	983-986	4
α-helix	987-989	3
α-helix	990-999	10
β-strand	1004-1007	4	1
β-strand	1012-1013	2	2
β-strand	1016-1017	2	2
α-helix	1024-1025	2
β-strand	1032-1035	4	1
β-strand	1038-1047	10	1
β-strand	1051-1060	10	1
β-strand	1066-1074	9	1
α-helix	1086-1106	21
α-helix	1115-1116	2
β-strand	1117-1120	4	1
α-helix	1126-1142	17
α-helix	1149-1159	11
α-helix	1167-1184	18

Chain B: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	57-64	8	1
β-strand	71-78	8	1
α-helix	80-91	12
α-helix	99-102	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 14	A	protein	303	Homo sapiens	Q15678 (AlphaFold model)
HPV18 E7	B	protein	55	Human papillomavirus type 18	P06788 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6IWD_1 Tyrosine-protein phosphatase non-receptor type 14 (chains A)
MVDATRVPMDERFRTLKKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVP
YEENRVELIPTKENNTGYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNV
IAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSG
QERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAG
VGRTGVLILSELMIYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNS
RLI

Sequence of entity 2 (B), FASTA

>6IWD_2 HPV18 E7 (chains B)
GHMAEPQRHTMLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCASQQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
PO4	Phosphate ion	O4 P	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural basis for recognition of the tumor suppressor protein PTPN14 by the oncoprotein E7 of human papillomavirus. Yun, H.Y., Kim, M.W., Lee, H.S. et al. PLoS Biol (2019) 17:e3000367-e3000367. DOI 10.1371/journal.pbio.3000367 · PubMed

Other PDB entries of the same protein (UniProt Q15678 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BZL 1.65 Å, Crystal structure of the human protein tyrosine phosphatase N14 at 1. 65 a resolution
6JJW 2.4 Å, Crystal Structure of KIBRA and PTPN14 complex

Browse structure collections

About this viewer

MolViewer shows 6IWD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.