2C30: Human P21-Activated Kinase 6

Crystal Structure Of The Human P21-Activated Kinase 6. Determined by X-ray diffraction at 1.6 Å resolution. Released 8 Feb 2006.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,691
Mol. weight: 36.81 kDa
Ligands: PO4
Released: 8 Feb 2006

Explore 2C30 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2C30 contains 19 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	387-395	9
α-helix	399	1
α-helix	403-406	4
β-strand	407-416	10	1
β-strand	419-426	8	1
β-strand	432-439	8	1
α-helix	446-456	11
β-strand	464	1	2
β-strand	467-473	7	1
β-strand	476-481	6	1
β-strand	488	1	2
α-helix	489-493	5
α-helix	500-519	20
β-strand	522-523	2	3
α-helix	529-531	3
β-strand	532-534	3	2
β-strand	540-542	3	2
β-strand	549-550	2	3
β-strand	558	1	4
α-helix	565-567	3
α-helix	570-573	4
β-strand	578	1	4
α-helix	581-596	16
α-helix	606-615	10
α-helix	618-619	2
α-helix	624-626	3
α-helix	629-638	10
α-helix	647-648	2
α-helix	649-653	5
α-helix	656-660	5
α-helix	664-667	4
α-helix	668-673	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase pak 6	A	protein	321	HOMO SAPIENS	Q9NQU5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2C30_1 SERINE/THREONINE-PROTEIN KINASE PAK 6 (chains A)
MHHHHHHSSGVDLGTENLYFQSGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystal Structures of the P21-Activated Kinases Pak4, Pak5, and Pak6 Reveal Catalytic Domain Plasticity of Active Group II Paks. Eswaran, J., Lee, W.H., Debreczeni, J.E. et al. Structure (2007) 15:201. DOI 10.1016/J.STR.2007.01.001 · PubMed

Other PDB entries of the same protein (UniProt Q9NQU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4KS7 1.4 Å, PAK6 kinase domain in complex with PF-3758309
6QDR 1.61 Å, Crystal structure of 14-3-3sigma in complex with a PAK6 pT99 phosphopeptide
6QDS 1.72 Å, Crystal structure of 14-3-3sigma in complex with a PAK6 pT99 phosphopeptide stabilized…
4KS8 1.95 Å, PAK6 kinase domain in complex with sunitinib
2ODB 2.4 Å, The crystal structure of human cdc42 in complex with the CRIB domain of human…

Browse structure collections

About this viewer

MolViewer shows 2C30 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.