2C3E: The bovine mitochondrial ADP-ATP carrier

The bovine mitochondrial ADP-ATP carrier. Determined by X-ray diffraction at 2.8 Å resolution. Released 20 Oct 2005.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: BOS TAURUS
Chains: 1
Atoms: 2,515
Mol. weight: 38.04 kDa
Ligands: CDL, CXT
Released: 20 Oct 2005

Explore 2C3E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2C3E contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	8-37	30
α-helix	38-40	3
α-helix	53-64	12
α-helix	66-70	5
α-helix	73-98	26
α-helix	108-141	34
α-helix	156-172	17
α-helix	176-200	25
α-helix	210-226	17
α-helix	228-238	11
α-helix	253-259	7
α-helix	260-264	5
α-helix	268-270	3
α-helix	275-290	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adp/atp translocase 1	A	protein	297	BOS TAURUS	P02722 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2C3E_1 ADP/ATP TRANSLOCASE 1 (chains A)
SDQALSFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI
PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG
AAGATSLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSV
QGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQ
SGRKGADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFV

Ligands and cofactors

ID	Name	Formula	Copies
CDL	Cardiolipin	C81 H156 O17 P2	3
CXT	Carboxyatractyloside	C31 H46 O18 S2	1

Primary citation

Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers. Nury, H., Dahout-Gonzalez, C., Trezeguet, V. et al. FEBS Lett (2005) 579:6031. DOI 10.1016/J.FEBSLET.2005.09.061 · PubMed

Other PDB entries of the same protein (UniProt P02722 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OKC 2.2 Å, structure of mitochondrial ADP/ATP carrier in complex with carboxyatractyloside

Browse structure collections

About this viewer

MolViewer shows 2C3E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.