1OKC: Mitochondrial ADP/ATP carrier

structure of mitochondrial ADP/ATP carrier in complex with carboxyatractyloside. Determined by X-ray diffraction at 2.2 Å resolution. Released 7 Nov 2003.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: BOS TAURUS
Chains: 1
Atoms: 2,686
Mol. weight: 41.8 kDa
Ligands: PC1, LDM, CDL, CXT
Released: 7 Nov 2003

Explore 1OKC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OKC contains 17 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	4-24	21
α-helix	26-37	12
α-helix	38-40	3
α-helix	46-48	3
α-helix	53-64	12
α-helix	66-70	5
α-helix	74-99	26
α-helix	108-142	35
α-helix	156-167	12
α-helix	169-172	4
α-helix	176-199	24
α-helix	203-205	3
α-helix	209-238	30
α-helix	245-247	3
α-helix	253-264	12
α-helix	266-270	5
α-helix	273-291	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP, ATP carrier protein heart isoform T1	A	protein	297	BOS TAURUS	P02722 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1OKC_1 ADP, ATP CARRIER PROTEIN HEART ISOFORM T1 (chains A)
SDQALSFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI
PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG
AAGATSLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSV
QGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQ
SGRKGADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFV

Ligands and cofactors

ID	Name	Formula	Copies
PC1	1,2-diacyl-sn-glycero-3-phosphocholine	C44 H88 N O8 P	4
LDM	3-laurylamido-n,n'-dimethylpropylaminoxyde	C17 H36 N2 O2	2
CDL	Cardiolipin	C81 H156 O17 P2	3
CXT	Carboxyatractyloside	C31 H46 O18 S2	1

Primary citation

Structure of Mitochondrial Adp/ATP Carrier in Complex with Carboxyatractyloside. Pebay-Peyroula, E., Dahout-Gonzalez, C., Kahn, R. et al. Nature (2003) 426:39. DOI 10.1038/NATURE02056 · PubMed

Other PDB entries of the same protein (UniProt P02722 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2C3E 2.8 Å, The bovine mitochondrial ADP-ATP carrier

Browse more

1OKC is part of these collections:

About this viewer

MolViewer shows 1OKC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.