crystal structure of human mitogen-activated protein kinase kinase kinase 3 isoform 2 phox domain at 1.25 A resolution. Determined by X-ray diffraction at 1.25 Å resolution. Released 29 Nov 2005.
Explore 2C60 in 3D Show helices and sheets RCSB PDB PDBe
2C60 contains 5 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 44 | 1 | |
| β-strand | 45-51 | 7 | 1 |
| β-strand | 54-60 | 7 | 1 |
| α-helix | 61 | 1 | |
| α-helix | 64-65 | 2 | |
| α-helix | 66-77 | 12 | |
| β-strand | 82-86 | 5 | 1 |
| β-strand | 91-93 | 3 | 1 |
| α-helix | 97-109 | 13 | |
| β-strand | 116-121 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Human mitogen-activated protein kinase kinase kinase 3 isoform 2 | A | protein | 111 | HOMO SAPIENS | Q99759 (AlphaFold model) |
>2C60_1 HUMAN MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 3 ISOFORM 2 (chains A) MHHHHHHSSGVDLGTENLYFQSMGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKV TTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQD
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (GOL) are not listed.
Crystal Structure of Human Mitogen-Activated Protein Kinase Kinase Kinase 3 Isoform 2 Fox Domain at 1.25 A Resolution. Debreczeni, J.E., Salah, E., Papagrigoriou, E. et al. To be published.
Other PDB entries of the same protein (UniProt Q99759 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2C60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.