2C74: 14-3-3 Protein Eta (Human) Complexed to Peptide

14-3-3 Protein Eta (Human) Complexed to Peptide. Determined by X-ray diffraction at 2.7 Å resolution. Released 2 Dec 2005.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: HOMO SAPIENS, synthetic construct
Chains: 4
Atoms: 3,672
Mol. weight: 58.78 kDa
Ligands: CIT
Released: 2 Dec 2005

Explore 2C74 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2C74 contains 28 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	3-16	14
α-helix	20-31	12
α-helix	36-38	3
α-helix	39-72	34
α-helix	76-103	28
α-helix	104-108	5
α-helix	117-135	19
α-helix	140-164	25
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-206	17
α-helix	208-210	3
α-helix	213-215	3
α-helix	216-234	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein eta	A, B	protein	247	HOMO SAPIENS	Q04917 (AlphaFold model)
Consensus peptide mode 1 for 14-3-3 proteins	P, Q	protein	7	synthetic construct

Sequence of entity 1 (A, B), FASTA

>2C74_1 14-3-3 PROTEIN ETA (chains A, B)
SMGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSS
WRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYES
KVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNF
SVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQD
EEAGEGN

Sequence of entity 2 (P, Q), FASTA

>2C74_2 CONSENSUS PEPTIDE MODE 1 FOR 14-3-3 PROTEINS (chains P, Q)
RRQRSAP

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	1

Primary citation

Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang, X., Lee, W.H., Sobott, F. et al. Proc Natl Acad Sci U S A (2006) 103:17237-17242. DOI 10.1073/pnas.0605779103 · PubMed

Other PDB entries of the same protein (UniProt Q04917 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2C63 2.15 Å, 14-3-3 Protein Eta (Human) Complexed to Peptide
7NMZ 2.3 Å, Structure of 14-3-3 eta in complex with Nedd4-2(335-455) containing two 14-3-3 binding…
9R2I 3.3 Å, Cryo-EM structure of the complex CDK16:CCNY:14-3-3
9R2N 3.83 Å, Cryo-EM structure of the complex CCNY:14-3-3

Browse structure collections

About this viewer

MolViewer shows 2C74 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.