2C9N: BZLF1 trans-activator protein

Structure of the Epstein-Barr virus ZEBRA protein at approximately 3. 5 Angstrom resolution. Determined by X-ray diffraction at 3.3 Å resolution. Released 21 Feb 2006.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: HUMAN HERPESVIRUS 4
Chains: 4
Atoms: 1,414
Mol. weight: 21.56 kDa
Released: 21 Feb 2006

Explore 2C9N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2C9N contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain Y: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	179-221	43
α-helix	227-230	4

Chain Z: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	179-221	43
α-helix	227-229	3
α-helix	232-234	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(cpapcptpgpapcptpcpap *T)-3'	A	DNA	11	HUMAN HERPESVIRUS 4
5'-d(cpaptpgpapgptpcpapgp *T)-3'	B	DNA	11	HUMAN HERPESVIRUS 4
BZLF1 trans-activator protein	Y, Z	protein	63	HUMAN HERPESVIRUS 4	P03206 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2C9N_1 5'-D(*CP*AP*CP*TP*GP*AP*CP*TP*CP*AP *T)-3' (chains A)
CACTGACTCAT

Sequence of entity 2 (B), FASTA

>2C9N_2 5'-D(*CP*AP*TP*GP*AP*GP*TP*CP*AP*GP *T)-3' (chains B)
CATGAGTCAGT

Sequence of entity 3 (Y, Z), FASTA

>2C9N_3 BZLF1 TRANS-ACTIVATOR PROTEIN (chains Y, Z)
MLEIKRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPR
TPD

Primary citation

Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein. Petosa, C., Morand, P., Baudin, F. et al. Mol Cell (2006) 21:565. DOI 10.1016/J.MOLCEL.2006.01.006 · PubMed

Other PDB entries of the same protein (UniProt P03206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SPV 1.3 Å, Crystal structure of a peptide-HLA complex
3VFN 1.5 Å, crystal structure of HLA B*3508LPEP151A, HLA mutant Ala151
1ZSD 1.7 Å, Crystal Structure Of HLA-B*3501 Presenting an 11-Mer EBV Antigen EPLPQGQLTAY
3VFO 1.7 Å, crystal structure of HLA B*3508 LPEP157A, HLA mutant Ala157
2AXF 1.8 Å, The Immunogenicity of a Viral Cytotoxic T Cell Epitope is controlled by its MHC-bound…
3VFP 1.85 Å, crystal structure of HLA B*3508 LPEP158G, HLA mutant Gly158
3VFR 1.85 Å, crystal structure of HLA B*3508LPEP-P4Ala, peptide mutant P4-ala
2AXG 2.0 Å, The Immunogenicity of a Viral Cytotoxic T Cell Epitope is controlled by its MHC-bound…
3KWW 2.18 Å, Crystal structure of the 'restriction triad' mutant of HLA B*3508, beta-2-microglobulin…
2C9L 2.25 Å, Structure of the Epstein-Barr virus ZEBRA protein
5SZX 2.25 Å, Epstein-Barr virus Zta DNA binding domain homodimer in complex with methylated DNA
2AK4 2.5 Å, Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide

Browse structure collections

About this viewer

MolViewer shows 2C9N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.