Structure of the Epstein-Barr virus ZEBRA protein at approximately 3. 5 Angstrom resolution. Determined by X-ray diffraction at 3.3 Å resolution. Released 21 Feb 2006.
Explore 2C9N in 3D Show helices and sheets RCSB PDB PDBe
2C9N contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 179-221 | 43 | |
| α-helix | 227-230 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 179-221 | 43 | |
| α-helix | 227-229 | 3 | |
| α-helix | 232-234 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5'-d(*cp*ap*cp*tp*gp*ap*cp*tp*cp*ap *T)-3' | A | DNA | 11 | HUMAN HERPESVIRUS 4 | |
| 5'-d(*cp*ap*tp*gp*ap*gp*tp*cp*ap*gp *T)-3' | B | DNA | 11 | HUMAN HERPESVIRUS 4 | |
| BZLF1 trans-activator protein | Y, Z | protein | 63 | HUMAN HERPESVIRUS 4 | P03206 (AlphaFold model) |
>2C9N_1 5'-D(*CP*AP*CP*TP*GP*AP*CP*TP*CP*AP *T)-3' (chains A) CACTGACTCAT
>2C9N_2 5'-D(*CP*AP*TP*GP*AP*GP*TP*CP*AP*GP *T)-3' (chains B) CATGAGTCAGT
>2C9N_3 BZLF1 TRANS-ACTIVATOR PROTEIN (chains Y, Z) MLEIKRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPR TPD
Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein. Petosa, C., Morand, P., Baudin, F. et al. Mol Cell (2006) 21:565. DOI 10.1016/J.MOLCEL.2006.01.006 · PubMed
Other PDB entries of the same protein (UniProt P03206 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2C9N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.