2CAY: Vps36 N-terminal PH domain

Vps36 N-terminal PH domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 7 Apr 2006.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 2
Atoms: 2,331
Mol. weight: 33.98 kDa
Released: 7 Apr 2006

Explore 2CAY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CAY contains 9 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	0-2	3
β-strand	5-6	2	1
β-strand	9	1	2
β-strand	15	1	2
α-helix	17-18	2
β-strand	23-34	12	1
β-strand	37-38	2	1
β-strand	45-50	6	1
β-strand	53-58	6	1
α-helix	62-65	4
β-strand	67-70	4	1
α-helix	71-73	3
β-strand	74-80	7	1
β-strand	89-94	6	1
β-strand	256-260	5	1
α-helix	266-281	16

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	0-2	3
β-strand	5-6	2	3
β-strand	23-34	12	3
β-strand	37-38	2	3
β-strand	45-50	6	3
β-strand	53-58	6	3
α-helix	62-65	4
β-strand	67-70	4	3
α-helix	71-73	3
β-strand	74-80	7	3
β-strand	89-94	6	3
β-strand	256-260	5	3
α-helix	266-280	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting protein 36	A, B	protein	145	SACCHAROMYCES CEREVISIAE	Q06696 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2CAY_1 VACUOLAR PROTEIN SORTING PROTEIN 36 (chains A, B)
MAHHHHHHMEYWHYVETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQ
RIIYIDDAKPTQNSLGLELDDLAYVNYSSGFLTRSPRLILFFKDPSSSTEFVQLSFRKSD
GVLFSQATERALENILTEKNKHIFN

Primary citation

Escrt-I Core and Escrt-II Glue Domain Structures Reveal Role for Glue in Linking to Escrt-I and Membranes. Teo, H., Gill, D.J., Sun, J. et al. Cell (2006) 125:99. DOI 10.1016/J.CELL.2006.01.047 · PubMed

Other PDB entries of the same protein (UniProt Q06696 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J9U 2.0 Å, 2 Angstrom X-ray structure of the yeast ESCRT-I Vps28 C-terminus in complex with the…
1U5T 3.6 Å, Structure of the ESCRT-II endosomal trafficking complex
1W7P 3.6 Å, The crystal structure of endosomal complex ESCRT-II (VPS22/VPS25/VPS36)

Browse structure collections

About this viewer

MolViewer shows 2CAY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.