2CFP: Sugar Free Lactose Permease at acidic pH

Sugar Free Lactose Permease at acidic pH. Determined by X-ray diffraction at 3.3 Å resolution. Released 13 Mar 2006.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: ESCHERICHIA COLI
Chains: 1
Atoms: 3,295
Mol. weight: 47.49 kDa
Ligands: HG
Released: 13 Mar 2006

Explore 2CFP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CFP contains 34 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 0 β-strands

Element	Residues	Length
α-helix	8-12	5
α-helix	17-23	7
α-helix	31-32	2
α-helix	33-37	5
α-helix	38	1
α-helix	42-54	13
α-helix	60-67	8
α-helix	68-70	3
α-helix	76-79	4
α-helix	88	1
α-helix	89-95	7
α-helix	96-99	4
α-helix	105-109	5
α-helix	121-135	15
α-helix	140-142	3
α-helix	144-164	21
α-helix	168-171	4
α-helix	173-179	7
α-helix	180-183	4
α-helix	210-216	7
α-helix	220-231	12
α-helix	236-242	7
α-helix	245-249	5
α-helix	257-267	11
α-helix	270-276	7
α-helix	279-286	8
α-helix	289-307	19
α-helix	312-320	9
α-helix	322-324	3
α-helix	326-340	15
α-helix	346-349	4
α-helix	351-358	8
α-helix	359-399	41
α-helix	401-402	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lactose permease	A	protein	417	ESCHERICHIA COLI	P02920 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CFP_1 LACTOSE PERMEASE (chains A)
MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDTGIIFAAISLFSLLFQ
PLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNILVGSIVGGIYLGFCFNA
GAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALGASIVGIMFTINNQFVFWLGSGCALIL
AVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKLWFLSLYVIGVSCTYDVFD
QQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPLIINRIGGKNALLLAGTIMS
VRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQFEVRFSATIYLVCFCFFKQL
AMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFTLSGPGPLSLLRRQVNEVA

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	5

Primary citation

Structural Evidence for Induced Fit and a Mechanism for Sugar/H(+) Symport in Lacy. Mirza, O., Guan, L., Verner, G. et al. EMBO J (2006) 25:2038. DOI 10.1038/SJ.EMBOJ.7601028 · PubMed

Other PDB entries of the same protein (UniProt P02920 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9XOU 2.5 Å, CryoEM structure of LacY with Trimbody
6VBG 2.8 Å, Lactose permease complex with thiodigalactoside and nanobody 9043
2CFQ 2.95 Å, Sugar Free Lactose Permease at neutral pH
8YA0 2.97 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C)
6C9W 3.0 Å, Crystal Structure of a ligand bound LacY/Nanobody Complex
8YA3 3.27 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C) treated with DTT
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
5GXB 3.3 Å, crystal structure of a LacY/Nanobody complex
4ZYR 3.31 Å, Crystal structure of E. coli Lactose permease G46W/G262W bound to p-nitrophenyl…
2Y5Y 3.38 Å, Crystal structure of LacY in complex with an affinity inactivator
1PV6 3.5 Å, Crystal structure of lactose permease
4OAA 3.5 Å, Crystal structure of E. coli lactose permease G46W,G262W bound to sugar

Browse structure collections

About this viewer

MolViewer shows 2CFP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.