2CFQ: Sugar Free Lactose Permease at neutral pH

Sugar Free Lactose Permease at neutral pH. Determined by X-ray diffraction at 2.95 Å resolution. Released 13 Mar 2006.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: ESCHERICHIA COLI
Chains: 1
Atoms: 3,295
Mol. weight: 47.49 kDa
Ligands: HG
Released: 13 Mar 2006

Explore 2CFQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CFQ contains 33 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	7-26	20
α-helix	30-31	2
α-helix	32-38	7
α-helix	46-67	22
α-helix	75-82	8
α-helix	87-90	4
α-helix	91-95	5
α-helix	96-100	5
α-helix	105-108	4
α-helix	109-111	3
α-helix	116-119	4
α-helix	122-136	15
α-helix	140-143	4
α-helix	150-164	15
α-helix	167-170	4
α-helix	180-183	4
α-helix	210-216	7
α-helix	220-228	9
α-helix	229-234	6
α-helix	235-249	15
α-helix	254-257	4
α-helix	259-268	10
α-helix	269-273	5
α-helix	274-286	13
α-helix	288-306	19
α-helix	312-318	7
α-helix	321-340	20
α-helix	343-349	7
α-helix	350-357	8
α-helix	358-365	8
α-helix	367-370	4
α-helix	372-375	4
α-helix	377-396	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lactose permease	A	protein	417	ESCHERICHIA COLI	P02920 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CFQ_1 LACTOSE PERMEASE (chains A)
MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDTGIIFAAISLFSLLFQ
PLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNILVGSIVGGIYLGFCFNA
GAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALGASIVGIMFTINNQFVFWLGSGCALIL
AVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKLWFLSLYVIGVSCTYDVFD
QQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPLIINRIGGKNALLLAGTIMS
VRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQFEVRFSATIYLVCFCFFKQL
AMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFTLSGPGPLSLLRRQVNEVA

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	5

Primary citation

Structural Evidence for Induced Fit and a Mechanism for Sugar/H(+) Symport in Lacy. Mirza, O., Guan, L., Verner, G. et al. EMBO J (2006) 25:2038. DOI 10.1038/SJ.EMBOJ.7601028 · PubMed

Other PDB entries of the same protein (UniProt P02920 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9XOU 2.5 Å, CryoEM structure of LacY with Trimbody
6VBG 2.8 Å, Lactose permease complex with thiodigalactoside and nanobody 9043
8YA0 2.97 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C)
6C9W 3.0 Å, Crystal Structure of a ligand bound LacY/Nanobody Complex
8YA3 3.27 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C) treated with DTT
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
2CFP 3.3 Å, Sugar Free Lactose Permease at acidic pH
5GXB 3.3 Å, crystal structure of a LacY/Nanobody complex
4ZYR 3.31 Å, Crystal structure of E. coli Lactose permease G46W/G262W bound to p-nitrophenyl…
2Y5Y 3.38 Å, Crystal structure of LacY in complex with an affinity inactivator
1PV6 3.5 Å, Crystal structure of lactose permease
4OAA 3.5 Å, Crystal structure of E. coli lactose permease G46W,G262W bound to sugar

Browse structure collections

About this viewer

MolViewer shows 2CFQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.