2CFY: Human thioredoxin reductase 1

Crystal structure of human thioredoxin reductase 1. Determined by X-ray diffraction at 2.7 Å resolution. Released 9 Mar 2006.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: HOMO SAPIENS
Chains: 6
Atoms: 22,479
Mol. weight: 348.41 kDa
Ligands: FAD
Released: 9 Mar 2006

Explore 2CFY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CFY contains 121 α-helices and 180 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, D, E and F: 20 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
α-helix	22-32	11
β-strand	38-41	4	1
α-helix	45-47	3
α-helix	57-62	6
α-helix	64-85	22
β-strand	88	1	2
β-strand	96	1	3
α-helix	98-122	25
β-strand	126-128	3	1
β-strand	130-136	7	4
β-strand	139-144	6	4
β-strand	149-153	5	4
β-strand	154-159	6	1
β-strand	163-165	3	5
α-helix	173-176	4
β-strand	178	1	6
α-helix	180-183	4
β-strand	193-196	4	6
α-helix	200-211	12
β-strand	216-220	5	6
α-helix	230-242	13
β-strand	246-249	4	6
β-strand	251-260	10	7
β-strand	266-273	8	7
β-strand	279-284	6	7
β-strand	286-289	4	6
β-strand	293-295	3	5
α-helix	302-304	3
β-strand	316	1	8
β-strand	323	1	1
β-strand	329-331	3	1
β-strand	336	1	8
α-helix	343-358	16
α-helix	363-365	3
β-strand	372-374	3	9
β-strand	380-384	5	9
α-helix	387-394	8
α-helix	396-398	3
β-strand	399-406	8	9
α-helix	409-411	3
β-strand	421-428	8	9
α-helix	429-431	3
β-strand	434-441	8	9
α-helix	445-457	13
β-strand	461	1	9
α-helix	462-467	6
α-helix	469-471	3
α-helix	475-480	6
β-strand	485	1	9

Chain C: 21 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	17
α-helix	22-32	11
β-strand	38-41	4	17
α-helix	45-47	3
α-helix	57-62	6
α-helix	64-85	22
β-strand	88	1	18
β-strand	96	1	19
α-helix	98-122	25
β-strand	126-128	3	17
β-strand	130-136	7	20
β-strand	139-144	6	20
β-strand	149-153	5	20
β-strand	154-159	6	17
β-strand	163-165	3	21
α-helix	166-168	3
α-helix	173-176	4
β-strand	178	1	22
α-helix	180-183	4
β-strand	193-196	4	22
α-helix	200-211	12
β-strand	216-220	5	22
α-helix	230-242	13
β-strand	246-249	4	22
β-strand	251-260	10	23
β-strand	266-273	8	23
β-strand	279-284	6	23
β-strand	286-289	4	22
β-strand	293-295	3	21
α-helix	302-304	3
β-strand	316	1	24
β-strand	323	1	17
β-strand	329-331	3	17
β-strand	336	1	24
α-helix	343-358	16
α-helix	363-365	3
β-strand	372-374	3	25
β-strand	380-384	5	25
α-helix	387-394	8
α-helix	396-398	3
β-strand	399-406	8	25
α-helix	409-411	3
β-strand	421-428	8	25
α-helix	429-431	3
β-strand	434-441	8	25
α-helix	445-457	13
β-strand	461	1	25
α-helix	462-467	6
α-helix	469-471	3
α-helix	475-480	6
β-strand	485	1	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin reductase 1	A, B, C, D, E, F	protein	521	HOMO SAPIENS	Q16881

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>2CFY_1 THIOREDOXIN REDUCTASE 1 (chains A, B, C, D, E, F)
MHHHHHHSSGVDLGTENLYFQSMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKV
MVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDW
DRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFL
IATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTV
MVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEE
IIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILED
KVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEEN
IEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKC
GLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCGG

Ligands and cofactors

ID	Name	Formula	Copies
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	6

Primary citation

Crystal Structure of Human Thioredoxin Reductase 1. Debreczeni, J.E., Johansson, C., Kavanagh, K. et al. To be published.

Other PDB entries of the same protein (UniProt Q16881), best resolution first:

3QFA 2.2 Å, Crystal structure of the human thioredoxin reductase-thioredoxin complex
2ZZC 2.6 Å, Crystal structure of NADP(H):human thioredoxin reductase I
3QFB 2.6 Å, Crystal structure of the human thioredoxin reductase-thioredoxin complex
2J3N 2.8 Å, X-ray structure of human thioredoxin reductase 1
2ZZ0 2.8 Å, Crystal structure of human thioredoxin reductase I (SeCys 498 Cys)
9UIN 3.03 Å, Human thioredoxin reductase 1 (SeCys 498 Cys) with Cu(I)
2ZZB 3.2 Å, Crystal structure of human thioredoxin reductase I and terpyridine platinum(II)
7X1R 3.9 Å, Cryo-EM structure of human thioredoxin reductase bound by Au

Browse structure collections

About this viewer

MolViewer shows 2CFY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.