2CHB: Cholera toxin B-pentamer

Name: PDB 2CHB: Cholera toxin B-pentamer complexed with GM1 pentasaccharide
Published: 1997-12-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Cholera toxin B-pentamer complexed with GM1 pentasaccharide. Determined by X-ray diffraction at 2.0 Å resolution. Released 3 Dec 1997.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Vibrio cholerae
Chains: 5
Atoms: 4,774
Mol. weight: 63.44 kDa
Released: 3 Dec 1997

Explore 2CHB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CHB contains 20 α-helices and 30 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-30	5	1
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	61-78	18
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Chain E: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-30	5	1
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-61	3
α-helix	62-78	17
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Chain F: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-30	5	1
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	60-77	18
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Chain G: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-30	5	1
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-78	20
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Chain H: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-30	5	1
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	61-77	17
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cholera toxin	D, E, F, G, H	protein	104	Vibrio cholerae	P01556 (AlphaFold model)

Sequence of entity 1 (D, E, F, G, H), FASTA

>2CHB_1 CHOLERA TOXIN (chains D, E, F, G, H)
MTPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHID
SQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

Primary citation

Structural studies of receptor binding by cholera toxin mutants. Merritt, E.A., Sarfaty, S., Jobling, M.G. et al. Protein Sci (1997) 6:1516-1528. PubMed

Other PDB entries of the same protein (UniProt P01556 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LZG 1.13 Å, Cholera toxin El Tor B-pentamer in complex with inhibitor PC262
5LZJ 1.2 Å, Cholera toxin El Tor B-pentamer in complex with inhibitor Laura237
3CHB 1.25 Å, Cholera toxin B-pentamer complexed with GM1 pentasaccharide
1JR0 1.3 Å, Cholera toxin B-pentamer with ligand bmsc-0011
1RDP 1.35 Å, Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV3
1RF2 1.35 Å, Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV4
1RD9 1.44 Å, Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV2
1MD2 1.45 Å, Cholera toxin B-pentamer with decavalent ligand bmsc-0013
5ELC 1.5 Å, Cholera toxin El Tor B-pentamer in complex with Lewis-y
6HJD 1.54 Å, Cholera toxin classical B-pentamer in complex with Lewis-x
5ELF 1.55 Å, Cholera toxin El Tor B-pentamer in complex with A-pentasaccharide
1RCV 1.6 Å, Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV1

Browse more

2CHB is part of these collections:

Toxins and how they work

About this viewer

MolViewer shows 2CHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.