2CHD: C2A domain of Rabphilin-3A

Crystal structure of the C2A domain of Rabphilin-3A. Determined by X-ray diffraction at 1.92 Å resolution. Released 28 Jun 2006.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: RATTUS NORVEGICUS
Chains: 1
Atoms: 1,124
Mol. weight: 16.31 kDa
Released: 28 Jun 2006

Explore 2CHD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CHD contains 7 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	385-393	9	1
α-helix	394-396	3
β-strand	398-407	10	1
α-helix	409-411	3
β-strand	420-427	8	2
α-helix	432-434	3
β-strand	435-437	3	2
α-helix	438-441	4
β-strand	448-456	9	1
α-helix	460-465	6
β-strand	467-475	9	2
β-strand	481-490	10	2
α-helix	491-493	3
α-helix	494-495	2
β-strand	500-505	6	1
β-strand	507	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rabphilin-3A	A	protein	142	RATTUS NORVEGICUS	P47709 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CHD_1 RABPHILIN-3A (chains A)
GSEANSYDSDQATTLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLP
GASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETR
FSLKKLKANQRKNFNICLERVI

Primary citation

Structure of the C2A Domain of Rabphilin-3A. Biadene, M., Montaville, P., Sheldrick, G.M. et al. Acta Crystallogr D Biol Crystallogr (2006) 62:793. DOI 10.1107/S0907444906017537 · PubMed

Other PDB entries of the same protein (UniProt P47709 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CM5 1.28 Å, crystal structure of the C2B domain of rabphilin
4NS0 1.8 Å, The C2A domain of Rabphilin 3A in complex with PI(4,5)P2
2CM6 1.85 Å, crystal structure of the C2B domain of rabphilin3A
4NP9 1.92 Å, Structure of Rabphilin C2A domain bound to IP3
4LT7 2.5 Å, Crystal structure of the c2a domain of rabphilin-3a in complex with a calcium
5LO8 2.5 Å, The C2B domain of Rabphilin 3A in complex with PI(4,5)P2
1ZBD 2.6 Å, Structural basis of rab effector specificity: crystal structure of the small G protein…
5LOW 2.8 Å, Structure of the Ca2+-bound Rabphilin 3A C2B domain SNAP25 complex (P21 space group)
5LOB 3.3 Å, Structure of the Ca2+-bound Rabphilin3A C2B- SNAP25 complex (C2 space group)
3RPB The C2B-domain of rabphilin: structural variations in a janus-faced domain

Browse structure collections

About this viewer

MolViewer shows 2CHD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.