3RPB: Rabphilin 3-a

The C2B-domain of rabphilin: structural variations in a janus-faced domain. Determined by solution NMR. Released 23 Dec 1999.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 1,143
Mol. weight: 16.25 kDa
Released: 23 Dec 1999

Explore 3RPB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RPB contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	543-551	9	1
β-strand	556-565	10	1
β-strand	578-585	8	2
β-strand	593	1	2
β-strand	606-610	5	1
β-strand	613	1	1
α-helix	617-620	4
β-strand	624-631	8	2
β-strand	639-647	9	2
α-helix	654-663	10
β-strand	669-674	6	1
β-strand	676	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rabphilin 3-a	A	protein	140	Rattus norvegicus	P47709 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3RPB_1 RABPHILIN 3-A (chains A)
RGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKK
KTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYE
CLKNKDKKIERWHQLQNENH

Primary citation

Structure of the Janus-faced C2B domain of rabphilin. Ubach, J., Garcia, J., Nittler, M.P. et al. Nat Cell Biol (1999) 1:106-112. DOI 10.1038/10076 · PubMed

Other PDB entries of the same protein (UniProt P47709 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CM5 1.28 Å, crystal structure of the C2B domain of rabphilin
4NS0 1.8 Å, The C2A domain of Rabphilin 3A in complex with PI(4,5)P2
2CM6 1.85 Å, crystal structure of the C2B domain of rabphilin3A
2CHD 1.92 Å, Crystal structure of the C2A domain of Rabphilin-3A
4NP9 1.92 Å, Structure of Rabphilin C2A domain bound to IP3
4LT7 2.5 Å, Crystal structure of the c2a domain of rabphilin-3a in complex with a calcium
5LO8 2.5 Å, The C2B domain of Rabphilin 3A in complex with PI(4,5)P2
1ZBD 2.6 Å, Structural basis of rab effector specificity: crystal structure of the small G protein…
5LOW 2.8 Å, Structure of the Ca2+-bound Rabphilin 3A C2B domain SNAP25 complex (P21 space group)
5LOB 3.3 Å, Structure of the Ca2+-bound Rabphilin3A C2B- SNAP25 complex (C2 space group)

Browse structure collections

About this viewer

MolViewer shows 3RPB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.