2CIU: PDB entry 2CIU

Structure of the IMS domain of the mitochondrial import protein Tim21 from S. cerevisiae. Determined by X-ray diffraction at 1.6 Å resolution. Released 21 Dec 2006.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 1,170
Mol. weight: 14.76 kDa
Released: 21 Dec 2006

Explore 2CIU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CIU contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	104-118	15
α-helix	120-125	6
β-strand	131	1	1
β-strand	134	1	1
β-strand	139-142	4	2
β-strand	144-146	3	3
β-strand	151-153	3	3
α-helix	154-156	3
β-strand	158-162	5	2
β-strand	168-177	10	2
β-strand	182-190	9	2
α-helix	198	1
β-strand	199-206	8	2
β-strand	213-216	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Import inner membrane translocase subunit TIM21 mitochondrial	A	protein	127	SACCHAROMYCES CEREVISIAE	P53220 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CIU_1 IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM21 MITOCHONDRIAL (chains A)
GAMGSGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVS
TKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKP
KLHPVSN

Primary citation

The Tim21 Binding Domain Connects the Preprotein Translocases of Both Mitochondrial Membranes. Albrecht, R., Rehling, P., Chacinska, A. et al. EMBO Rep (2006) 7:1233. DOI 10.1038/SJ.EMBOR.7400828 · PubMed

Other PDB entries of the same protein (UniProt P53220 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6K7E 1.53 Å, Crystal structure of MBPapo-Tim21 fusion protein with a 17-residue helical linker
6K7F 1.8 Å, Crystal structure of MBPholo-Tim21 fusion protein with a 17-residue helical linker
6K7D 2.0 Å, Crystal structure of MBPapo-Tim21 fusion protein with a 16-residue helical linker
2MF7 Solution structure of the ims domain of the mitochondrial import protein TIM21 from S.…
6K8Q Solution structure of the intermembrane space domain of the mitochondrial import protein…

Browse structure collections

About this viewer

MolViewer shows 2CIU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.