2CNJ: Cation-independent mannose-6-phosphate receptor

Name: PDB 2CNJ: NMR studies on the interaction of Insulin-Growth Factor II (IGF-II) with IGF2R domain 11
Published: 2007-05-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: receptor

NMR studies on the interaction of Insulin-Growth Factor II (IGF-II) with IGF2R domain 11. Determined by solution NMR. Released 22 May 2007.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,087
Mol. weight: 16.65 kDa
Released: 22 May 2007

Explore 2CNJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CNJ contains 3 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	1517-1519	3	1
β-strand	1526-1528	3	1
β-strand	1533	1	2
β-strand	1538-1542	5	3
β-strand	1546-1550	5	3
β-strand	1552	1	2
β-strand	1563-1567	5	3
β-strand	1575-1576	2	3
β-strand	1582-1584	3	4
β-strand	1587-1590	4	4
β-strand	1597	1	5
α-helix	1598	1
β-strand	1605	1	5
β-strand	1607-1614	8	4
α-helix	1623-1624	2
β-strand	1625-1630	6	4
β-strand	1635-1642	8	4
α-helix	1643-1645	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cation-independent mannose-6-phosphate receptor	D	protein	151	HOMO SAPIENS	P11717 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>2CNJ_1 CATION-INDEPENDENT MANNOSE-6-PHOSPHATE RECEPTOR (chains D)
MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACF
GQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLI
SLDKQTCTLFFSWHTPLACEQATKEHHHHHH

Primary citation

Structural Insights Into the Interaction of Insulin-Like Growth Factor 2 with Igf2R Domain 11. Williams, C., Rezgui, D., Prince, S.N. et al. Structure (2007) 15:1065. DOI 10.1016/J.STR.2007.07.007 · PubMed

Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GP0 1.4 Å, Human IGF2R domain 11
6Z30 1.5 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domains 9-10
1E6F 1.75 Å, Human MIR-receptor, repeat 11
1GQB 1.8 Å, Human mir-receptor, repeat 11
1GP3 1.95 Å, Human IGF2R domain 11
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
1JPL 2.4 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose…
6V02 2.46 Å, N-terminal 5 domains of CI-MPR
6P8I 2.54 Å, N-terminal 5 domains of IGFIIR

Browse structure collections

About this viewer

MolViewer shows 2CNJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.