6Z30: Cation-independent mannose-6-phosphate receptor

Human cation-independent mannose 6-phosphate/ IGF2 receptor domains 9-10. Determined by X-ray diffraction at 1.5 Å resolution. Released 19 Aug 2020.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,732
Mol. weight: 34.72 kDa
Released: 19 Aug 2020

Explore 6Z30 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Z30 contains 12 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	1228-1230	3	1
β-strand	1237-1239	3	1
α-helix	1241-1244	4
β-strand	1248-1252	5	2
β-strand	1255-1259	5	2
β-strand	1279-1285	7	2
α-helix	1286	1
β-strand	1291-1297	7	2
β-strand	1303-1305	3	3
β-strand	1308-1313	6	3
β-strand	1318-1319	2	4
β-strand	1323-1324	2	4
β-strand	1326-1332	7	3
β-strand	1337	1	5
α-helix	1338-1340	3
β-strand	1341-1345	5	3
β-strand	1350-1356	7	3
β-strand	1357	1	5
α-helix	1358-1360	3
α-helix	1361-1363	3
β-strand	1366	1	6
β-strand	1370-1372	3	7
β-strand	1378-1380	3	7
α-helix	1382-1384	3
β-strand	1391-1392	2	8
α-helix	1393	1
β-strand	1394	1	9
β-strand	1402-1405	4	8
β-strand	1409	1	6
α-helix	1410-1413	4
α-helix	1419-1421	3
β-strand	1426-1429	4	8
β-strand	1435-1436	2	8
β-strand	1439	1	10
β-strand	1445-1447	3	9
β-strand	1450-1455	6	9
β-strand	1456	1	10
β-strand	1460	1	11
α-helix	1461	1
β-strand	1467	1	11
β-strand	1469-1476	8	9
β-strand	1486-1491	6	9
β-strand	1495-1502	8	9
α-helix	1503-1505	3
α-helix	1507-1508	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cation-independent mannose-6-phosphate receptor	A	protein	302	Homo sapiens	P11717 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6Z30_1 Cation-independent mannose-6-phosphate receptor (chains A)
ETGASVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTYYFRVCGKLSSDVCPTSDKS
KVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCHKVYQRSTAIFFYCDRG
TQRPVFLKETSDCSYLFEWRTQYACPPFDLTECSFKDGAGNSFDLSSLSRYSDNWEAITG
TGDPEHYLINVCKSLAPQAGTEPCPPEAAACLLGGSKPVNLGRVRDGPQWRDGIIVLKYV
DGDLCPDGIRKKSTTIRFTCSESQVNSRPMFISAVEDCEYTFAWPTATACPMKSTRHHHH
HH

Primary citation

Structure of the Human Cation-Independent Mannose 6-Phosphate/IGF2 Receptor Domains 7-11 Uncovers the Mannose 6-Phosphate Binding Site of Domain 9. Bochel, A.J., Williams, C., McCoy, A.J. et al. Structure (2020) 28:1300-1312.e5. DOI 10.1016/j.str.2020.08.002 · PubMed

Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GP0 1.4 Å, Human IGF2R domain 11
1E6F 1.75 Å, Human MIR-receptor, repeat 11
1GQB 1.8 Å, Human mir-receptor, repeat 11
1GP3 1.95 Å, Human IGF2R domain 11
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
1JPL 2.4 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose…
6V02 2.46 Å, N-terminal 5 domains of CI-MPR
6P8I 2.54 Å, N-terminal 5 domains of IGFIIR
6Z31 2.56 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domain 8

Browse structure collections

About this viewer

MolViewer shows 6Z30 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.