2COB: HTH domain of human LCoR protein

Solution structures of the HTH domain of human LCoR protein. Determined by solution NMR. Released 17 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 544
Mol. weight: 7.82 kDa
Released: 17 Nov 2005

Explore 2COB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2COB contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	16-27	12
α-helix	33-40	8
α-helix	44-54	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LCoR protein	A	protein	70	Homo sapiens	Q96JN0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2COB_1 LCoR protein (chains A)
GSSGSSGRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKN
PPKKKMKLMR

Primary citation

Solution structures of the HTH domain of human LCoR protein. Nameki, N., Umehara, T., Sato, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q96JN0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V3Y 1.63 Å, Crystal structure of EED in complex with PALI1-K1219me3 peptide
6V3X 1.7 Å, Crystal structure of EED in complex with PALI1-K1241me3 peptide
9WRJ 2.2 Å, Crystal structure of CtBP1 in complex with PALI1

Browse structure collections

About this viewer

MolViewer shows 2COB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.