Crystal structure of EED in complex with PALI1-K1219me3 peptide. Determined by X-ray diffraction at 1.63 Å resolution. Released 26 May 2021.
Explore 6V3Y in 3D Show helices and sheets RCSB PDB PDBe
6V3Y contains 7 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 83-89 | 7 | 1 |
| β-strand | 96-101 | 6 | 2 |
| α-helix | 105-106 | 2 | |
| α-helix | 110 | 1 | |
| β-strand | 111-117 | 7 | 2 |
| β-strand | 120-126 | 7 | 2 |
| β-strand | 132-139 | 8 | 2 |
| β-strand | 147-154 | 8 | 3 |
| β-strand | 161-167 | 7 | 3 |
| β-strand | 171-175 | 5 | 3 |
| β-strand | 182-187 | 6 | 3 |
| β-strand | 193-198 | 6 | 4 |
| β-strand | 205-210 | 6 | 4 |
| β-strand | 215-219 | 5 | 4 |
| β-strand | 224-229 | 6 | 4 |
| β-strand | 239-244 | 6 | 5 |
| β-strand | 250-255 | 6 | 5 |
| β-strand | 260-264 | 5 | 5 |
| α-helix | 268-279 | 12 | |
| α-helix | 282-284 | 3 | |
| α-helix | 288-291 | 4 | |
| β-strand | 292-294 | 3 | 4 |
| β-strand | 299-301 | 3 | 5 |
| β-strand | 311-315 | 5 | 6 |
| β-strand | 318-322 | 5 | 6 |
| β-strand | 327-333 | 7 | 6 |
| α-helix | 340-342 | 3 | |
| β-strand | 350-357 | 8 | 6 |
| β-strand | 369-370 | 2 | 7 |
| β-strand | 376-380 | 5 | 7 |
| β-strand | 386-390 | 5 | 7 |
| α-helix | 396-398 | 3 | |
| β-strand | 400-404 | 5 | 7 |
| β-strand | 413-418 | 6 | 1 |
| β-strand | 424-429 | 6 | 1 |
| β-strand | 433-438 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polycomb protein EED | A | protein | 359 | Homo sapiens | O75530 (AlphaFold model) |
| PALI1 peptide | B | protein | 5 | Homo sapiens | Q96JN0 (AlphaFold model) |
>6V3Y_1 Polycomb protein EED (chains A) SFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVD ADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHP RDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSL KLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLIL SKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALG NQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR
>6V3Y_2 PALI1 peptide (chains B) LQKYA
PALI1 facilitates DNA and nucleosome binding by PRC2 and triggers an allosteric activation of catalysis. Zhang, Q., Agius, S.C., Flanigan, S.F. et al. Nat Commun (2021) 12:4592-4592. DOI 10.1038/s41467-021-24866-3 · PubMed
Other PDB entries of the same protein (UniProt O75530 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6V3Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.