Solution structure of the La domain of c-Mpl binding protein. Determined by solution NMR. Released 20 Nov 2005.
Explore 2CQK in 3D Show helices and sheets RCSB PDB PDBe
2CQK contains 6 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 46-60 | 15 | |
| α-helix | 63-68 | 6 | |
| α-helix | 70-75 | 6 | |
| β-strand | 82-83 | 2 | 1 |
| α-helix | 84-89 | 6 | |
| α-helix | 91-96 | 6 | |
| α-helix | 100-109 | 10 | |
| β-strand | 113-115 | 3 | 1 |
| β-strand | 121-124 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| C-Mpl binding protein | A | protein | 101 | Homo sapiens | Q71RC2 (AlphaFold model) |
>2CQK_1 C-Mpl binding protein (chains A) GSSGSSGAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKK LTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCISGPSSG
Solution structure of the La domain of c-Mpl binding protein. Suzuki, S., Muto, Y., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q71RC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2CQK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.