6I9B: La module from human LARP4A

NMR structure of the La module from human LARP4A. Determined by solution NMR. Released 13 Mar 2019.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,441
Mol. weight: 20.58 kDa
Released: 13 Mar 2019

Explore 6I9B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I9B contains 9 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	116-130	15
α-helix	133-136	4
α-helix	140-145	6
α-helix	154-158	5
α-helix	161-164	4
α-helix	170-177	8
β-strand	183-185	3	1
β-strand	192-194	3	1
β-strand	200-203	4	2
α-helix	212-219	8
α-helix	225-227	3
β-strand	229-233	5	2
β-strand	237-241	5	2
α-helix	245-258	14
β-strand	269-272	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
La-related protein 4	A	protein	177	Homo sapiens	Q71RC2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6I9B_1 La-related protein 4 (chains A)
NSAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDP
DLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETTPIEEVKGLFKSENCPKVISC
EFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAKNGYRLMD

Primary citation

LARP4A recognizes polyA RNA via a novel binding mechanism mediated by disordered regions and involving the PAM2w motif, revealing interplay between PABP, LARP4A and mRNA. Cruz-Gallardo, I., Martino, L., Kelly, G. et al. Nucleic Acids Res (2019) 47:4272-4291. DOI 10.1093/nar/gkz144 · PubMed

Other PDB entries of the same protein (UniProt Q71RC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PKN 1.8 Å, Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif…
2CQK Solution structure of the La domain of c-Mpl binding protein

Browse structure collections

About this viewer

MolViewer shows 6I9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.