2CQK: La domain of c-Mpl binding protein

Solution structure of the La domain of c-Mpl binding protein. Determined by solution NMR. Released 20 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 782
Mol. weight: 11.24 kDa
Released: 20 Nov 2005

Explore 2CQK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CQK contains 6 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	46-60	15
α-helix	63-68	6
α-helix	70-75	6
β-strand	82-83	2	1
α-helix	84-89	6
α-helix	91-96	6
α-helix	100-109	10
β-strand	113-115	3	1
β-strand	121-124	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-Mpl binding protein	A	protein	101	Homo sapiens	Q71RC2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CQK_1 C-Mpl binding protein (chains A)
GSSGSSGAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKK
LTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCISGPSSG

Primary citation

Solution structure of the La domain of c-Mpl binding protein. Suzuki, S., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q71RC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PKN 1.8 Å, Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif…
6I9B NMR structure of the La module from human LARP4A

Browse structure collections

About this viewer

MolViewer shows 2CQK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.