Solution structure of RSGI RUH-034, a homeodomain from mouse cDNA. Determined by solution NMR. Released 20 Nov 2005.
Explore 2CQX in 3D Show helices and sheets RCSB PDB PDBe
2CQX contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-29 | 8 | |
| α-helix | 36-45 | 10 | |
| α-helix | 50-64 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| LAG1 longevity assurance homolog 5 | A | protein | 72 | Mus musculus | Q9D6K9 (AlphaFold model) |
>2CQX_1 LAG1 longevity assurance homolog 5 (chains A) GSSGSSGGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVRKIQCWFRHR RNQDKPSGPSSG
Solution structure of RSGI RUH-034, a homeodomain from mouse cDNA. Ruhul Momen, A.Z.M., Onuki, H., Hirota, H. et al. To be published.
Other PDB entries of the same protein (UniProt Q9D6K9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2CQX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.