2CQX: RSGI RUH-034, a homeodomain from mouse cDNA

Solution structure of RSGI RUH-034, a homeodomain from mouse cDNA. Determined by solution NMR. Released 20 Nov 2005.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 565
Mol. weight: 8.05 kDa
Released: 20 Nov 2005

Explore 2CQX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CQX contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	22-29	8
α-helix	36-45	10
α-helix	50-64	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LAG1 longevity assurance homolog 5	A	protein	72	Mus musculus	Q9D6K9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CQX_1 LAG1 longevity assurance homolog 5 (chains A)
GSSGSSGGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVRKIQCWFRHR
RNQDKPSGPSSG

Primary citation

Solution structure of RSGI RUH-034, a homeodomain from mouse cDNA. Ruhul Momen, A.Z.M., Onuki, H., Hirota, H. et al. To be published.

Other PDB entries of the same protein (UniProt Q9D6K9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5E8O 1.98 Å, The structure of the TEIPP associated altered peptide ligand Trh4-p2ABU in complex with…
5E8P 2.0 Å, The structure of the TEIPP associated altered peptide ligand Trh4-p5NLE in complex with…
5E8N 2.25 Å, The structure of the TEIPP associated Trh4 peptide in complex with H-2D(b)

Browse structure collections

About this viewer

MolViewer shows 2CQX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.