2CR7: Paired amphipathic helix protein Sin3b

Solution structure of the first PAH domain of the mouse transcriptional repressor SIN3B. Determined by solution NMR. Released 20 Nov 2005.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 610
Mol. weight: 8.65 kDa
Released: 20 Nov 2005

Explore 2CR7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CR7 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	14-23	10
α-helix	28-42	15
α-helix	48-58	11
α-helix	59-61	3
α-helix	63-72	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Paired amphipathic helix protein Sin3b	A	protein	80	Mus musculus	Q62141 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CR7_1 Paired amphipathic helix protein Sin3b (chains A)
GSSGSSGVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFH
EHPDLIVGFNAFLPSGPSSG

Primary citation

Solution structure of the first PAH domain of the mouse transcriptional repressor SIN3B. Nagashima, K., Hayashi, F., Yoshida, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q62141 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1E91 Structure of the complex of the Mad1-Sin3B interaction domains
1PD7 Extended SID of Mad1 bound to the PAH2 domain of mSin3B
2CZY Solution structure of the NRSF/REST-mSin3B PAH1 complex
2F05 Solution structure of free PAH2 domain of mSin3B
5Y95 Haddock model of mSIN3B PAH1 domain

Browse structure collections

About this viewer

MolViewer shows 2CR7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.