Haddock model of mSIN3B PAH1 domain. Determined by solution NMR. Released 4 Oct 2017.
Explore 5Y95 in 3D Show helices and sheets RCSB PDB PDBe
5Y95 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 37-47 | 11 | |
| α-helix | 52-66 | 15 | |
| α-helix | 72-82 | 11 | |
| α-helix | 87-95 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Paired amphipathic helix protein Sin3b | A | protein | 80 | Mus musculus | Q62141 (AlphaFold model) |
>5Y95_1 Paired amphipathic helix protein Sin3b (chains A) GSSGSSGVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFH EHPDLIVGFNAFLPSGPSSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| 8TL | propan-2-yl (3R,6S,9aS)-3-ethyl-8-(3-methylbutyl)-6-(2-methylsulfanylethyl)-4,7… | C20 H35 N3 O5 S | 1 |
A mimetic of the mSin3-binding helix of NRSF/REST ameliorates abnormal pain behavior in chronic pain models. Ueda, H., Kurita, J.I., Neyama, H. et al. Bioorg Med Chem Lett (2017) 27:4705-4709. DOI 10.1016/j.bmcl.2017.09.006 · PubMed
Other PDB entries of the same protein (UniProt Q62141 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5Y95 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.