2CRC: PDB entry 2CRC

Solution structure of the zf-RanBP domain of the protein HBV associated factor. Determined by solution NMR. Released 20 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 370
Mol. weight: 5.4 kDa
Ligands: ZN
Released: 20 Nov 2005

Explore 2CRC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CRC contains 0 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	20	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin conjugating enzyme 7 interacting protein 3	A	protein	52	Homo sapiens	Q9BYM8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CRC_1 Ubiquitin conjugating enzyme 7 interacting protein 3 (chains A)
GSSGSSGPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPSGPSSG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Solution structure of the zf-RanBP domain of the protein HBV associated factor. Zhang, H.P., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt Q9BYM8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8K6Q 1.59 Å, Crystal structure of HOIL-1L LTM domain
9EGW 1.78 Å, HOIL-1 RING2 domain bound to ubiquitin-maltose (maltose not modelled)
7YUJ 1.86 Å, Crystal structure of HOIL-1L(365-510)
7V8E 1.9 Å, Crystal structure of IpaH1.4 LRR domain bound to HOIL-1L UBL domain.
9EGV 2.0 Å, HOIL-1 RING2 domain bound to ubiquitin
8BVL 2.24 Å, Crystal structure of the IBR-RING2 domain of HOIL-1
7YUI 2.6 Å, Crystal structure of HOIL-1L(195-423) in complex with the linear tetra-ubiquitin
4DBG 2.71 Å, Crystal structure of HOIL-1L-UBL complexed with a HOIP-UBA derivative
8EAZ 3.08 Å, HOIL-1/E2-Ub/Ub transthiolation complex
2LGY Ubiquitin-like domain from HOIL-1

Browse structure collections

About this viewer

MolViewer shows 2CRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.